KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5417Help
Entry
PSPTO_5417        CDS       T00118                                 

Definition
(RefSeq) serine/threonine phosphoprotein phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst02025  Biofilm formation - Pseudomonas aeruginosa
pst03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pst00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPTO_5417
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPTO_5417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTO_5417
Enzymes [BR:pst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PSPTO_5417
Secretion system [BR:pst02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSPTO_5417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 PP2C SpoIIE
Motif
Other DBs
NCBI-GeneID: 1187104
NCBI-ProteinID: NP_795144
UniProt: Q87U90
Position
complement(6156615..6157343)
Genome map
AA seq 242 aa AA seqDB search
MLVASPWRSAARTDAGKVRARNEDAFLDSPQHGLWVVADGMGGHQGGDVASQLIVASLAE
LPVQEGFDERLKGIRQCLHWLNRRLGQELTVTAGRHDSIMGSTVVALMVEGNRAACIWAG
DSRCYLWRGQRLYQLSKDHSLQQQLIDEEKMSVEQASAHPSAHALTRAVGAAEQLTLDVL
ELEVYPGDAFLLCSDGLYQGLGSDALGSALSLTAPQVALERLFDSALRGSARDNLTAVVI
RK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagccagcccttggcgcagcgctgcgcgtaccgatgccggcaaggtacgggcg
cgcaacgaagatgcttttctggactccccgcagcacgggctgtgggtggtcgcggatggc
atgggcggtcatcagggtggcgatgtcgccagtcagttgatcgtcgccagcctggcggaa
ctgcctgtgcaggaaggctttgacgaacgcctcaagggcattcgtcaatgtctgcactgg
ctcaaccgccgtctgggtcaggaactgacggtcactgcgggtcgccatgacagcatcatg
ggcagcacggtggtagcgctgatggttgagggtaatcgcgccgcctgtatctgggcgggc
gatagccgttgttacttgtggcgcggacagcgtctgtaccagctgtccaaagaccactcg
ctgcaacagcaattgatcgacgaggagaaaatgagcgtcgaacaggccagtgcccatcct
tccgcgcacgccttgacgcgcgcggtcggtgcggcagaacagttgaccctggatgtactg
gagcttgaggtatatcccggcgacgcatttttgctgtgtagcgatggtttgtatcaggga
cttggcagcgatgcgctcggtagcgccttgagtctgaccgcgccgcaggtagcgctggag
cgcttgttcgatagtgccttgcgtggttcggcgcgggataatctgacggccgtggtgatc
cgcaaatga

DBGET integrated database retrieval system