KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5418Help
Entry
PSPTO_5418        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst02025  Biofilm formation - Pseudomonas aeruginosa
pst03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pst00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPTO_5418
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPTO_5418
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTO_5418
Secretion system [BR:pst02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPTO_5418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AAA_23 AAA_29 RsgA_GTPase LMBR1 DUF4131
Motif
Other DBs
NCBI-GeneID: 1187105
NCBI-ProteinID: NP_795145
UniProt: Q87U89
Position
complement(6157343..6160921)
Genome map
AA seq 1192 aa AA seqDB search
MIRRRSSRSHSRKQGRMMKNFFKKVGAFLRKTWVWTLLLVLFVALLVWFVGPLLAVDDYR
FWESSTSRLLTISVLFLIWGLTMVFVSWRSGVRKKALEESEDGQDRIRREEQIDEEQKEL
KTRFKDALKTLKTSSLYRGRSERWRSDLPWYLLIGPQGSGKTSLLDFSGLEFPINKIERK
LTRDTLGTRHCDWYFADHGVLIDTAGRYLTQPDAEVDGSAWNTLLDLLRKRRRNRPLNGV
LVTIPVETLLNESEQNLETLARQVRARLQDVHQKLHVDVPIYLVLSKADRLLGFEEFFDQ
LTREESDQVLGTSFRKEQMGTDVAVLRTEFEELLRRLNSQVIMRMHQERDTQRRGRILDF
PHRLGQIGERLCLFVDLAFTGNRYQRVSQLRGFYLTSAPHLTEEMDATTAGIGANLGMSA
GVLPTLRSGRSRFIHHLLSRVIFPEADLAGLDKRERSRIHWGQRALYVGALVALALFGVL
WAGGFSANYSRLENLRSLAQTWTQQRSALSARDDSMAVLKTLDTSYAATQVFPEKGDVSY
HERGGLYQGEDVNPVVRVAYERELHDQLLPRVANLLESQIRANTKDRDRLLNSLRAYLML
NMTDRRDAQWLKDWVATEWSQRYTGNTAVQNGLNTHFDRLLKQPFSYPLNDPLVAQARQI
LRSESLATVVYRMLREQARNLPEYTLGQHLGPQGALFVGTDYTIPGFYTQQGYQQYFSVQ
GTKLVTDILSDNWVLGEGAGLSTMDLRRLMVELEQLYFRDYANYWGEAIGEVQLPAINDF
GEGAEQLAGLTSANSPVIQLLIEVRENTRFPVVADSAEEAADAAGQLAENGGKLGKLAVA
AAGKASDALAKKLPDTARKSLQSRFEPLHRLLDDNNGPTADLTPALAALNELQLQMASLA
RSSSPDQAAFEMAKSRMGGQRDALSNLRTASGRLPRPVGVWFNVLAEDTWRLVLGDSYQY
LNQRYQSELYSFYGKAISKRYPFDAHSASDVAISDFREFFKAQGIADRFFDNYMRPFVSG
DAGNYRMRSVDGYSLPVSKVYLDQMAAALVIRQSFFADNPAEPQVQFKLEPYTLDPAVSR
SEFKFGDKTIEYRHGPIVPVSFKWPTDAEDGRTSLVLDRMVGRPLGLEKNTGPWSLFRLF
DLMQTEYLTGRDVLVLKADVGGLRANYLLTSQRTPNPFDMGALRTFRMPGQL
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
ttgatccggcggcggtccagccgcagtcacagccgtaaacagggacgcatgatgaaaaac
ttcttcaagaaagtcggcgcattcctgcgcaagacatgggtctggacgctgctgctggtg
ctgtttgttgcgctgttggtgtggttcgtcggaccgctgctggcggttgatgattacagg
ttctgggaaagctccacctcgcgtttgctgactatcagtgtgctgttcctgatctggggc
ctgacgatggttttcgtcagttggcgctcgggtgttcgcaagaaagccctcgaagaaagc
gaagacggccaggatcgcatccgccgagaagagcagatcgacgaagagcagaaagaactg
aaaacgcgtttcaaggacgcgttgaaaacgctgaaaacgtcgagcctttatcgcggccgt
agcgaacgctggcgcagcgatctgccttggtacctgctgattggtccgcaaggcagtggt
aaaaccagcctgctggatttctcgggccttgagtttccaatcaacaagattgaacgcaaa
ctgacacgagacactctgggcacccgtcactgtgactggtacttcgccgatcacggcgtg
ctcatcgacaccgctggccgctacctgacccagcctgacgccgaagtcgacggcagtgcc
tggaacaccttgttggacctgctgcgcaaacgtcgccgcaatcgtccgctgaacggtgta
ctggtgaccattccggttgaaaccctgctgaatgaaagtgagcagaaccttgaaacactc
gctcgtcaggtgcgtgcgcgtttgcaggacgtgcatcagaaactgcacgtcgatgtgccc
atctatctggttctgagcaaggccgaccgcttgttgggctttgaagagttcttcgatcaa
ctgacgcgtgaagaaagcgatcaggtcctcggcacgagctttcgcaaagagcagatgggc
accgatgtggcggtgttgcgcaccgagttcgaagagctgctgcgtcgcctgaacagtcag
gtgatcatgcgcatgcatcaagagcgtgacacgcagcgtcgtggtcgtattctcgacttc
ccgcatcgactggggcagatcggcgagcgcctgtgcctgtttgtcgatctggcattcacg
ggtaaccgctaccagcgcgtcagtcagttgcgcggcttctacctgaccagtgcgccgcat
ctgacagaggaaatggacgctaccaccgctggcatcggcgccaatctgggcatgagtgca
ggtgtactgccaacgcttcgcagcggccgatcacgattcatccatcatctgctcagccgg
gtgatctttccggaagccgatctcgcgggactggacaagcgtgagcgcagtcgcatccat
tggggccaacgtgcgttgtacgtgggcgcgctggtagcgttggcgctgttcggcgtactg
tgggctggcggcttttcggccaactattcacgtctggaaaacctgcgcagtctggctcag
acctggactcagcaacgttcggcgctgagcgcccgcgatgactccatggcggtgctcaaa
acgctcgacaccagttacgcagccactcaagtgttcccggaaaaaggcgacgtgagttat
cacgagcgtggcggcctgtatcaaggcgaagacgtcaatccggtggtcagggtcgcttac
gaacgtgagcttcacgaccagttgctgccccgcgttgcaaacttgctggaaagccagatc
cgcgccaacaccaaggatcgcgaccgcctgctcaacagcctgcgtgcgtacctgatgctg
aacatgacggatcgccgcgacgctcagtggctcaaggattgggtcgctactgaatggtcc
cagcgctataccggcaacaccgcggtacagaacggtttgaacacccattttgatcgttta
ttgaaacagccattcagctatccgttgaatgatccgctggtggctcaggcgcgtcagatt
ctgcgtagcgagtctttggcgactgtggtttaccgcatgctgcgcgagcaggcccgtaat
ctgccggaatacactttgggccagcaccttggtcctcagggtgcgctgtttgtcggcacc
gattacacgatccccggcttctatacccaacagggctaccagcagtacttctcggttcag
ggcaccaagctggttactgacatccttagtgataactgggtgctgggtgaaggtgccggt
ctcagcacgatggacttgcgccgcctgatggttgaactggagcagctgtacttccgcgac
tacgccaactattggggggaggcgataggtgaggtccaactgccagcaatcaatgacttt
ggggaaggcgctgagcagttggcaggtctgacgtcagccaactccccggtcatccagttg
ctgatagaggtgcgtgaaaatacacgcttcccggtggttgccgattcggcggaagaagct
gccgatgcagcagggcaactggcagagaatggtggcaagcttggcaaactggccgttgcc
gcagcaggcaaggcatctgatgcattggcgaaaaagctgccggataccgcgaggaagtct
ctgcaaagtcgcttcgagccgttgcaccgcttgctggatgacaacaatgggccgactgcc
gacctgacgcctgccctggccgctcttaatgagctgcaactgcagatggcgagccttgca
cgttccagctcgccggatcaggccgcctttgaaatggccaaaagccgaatgggtggccag
cgcgacgcgctgagcaatctgcgcacggcgtccggtcgtttgccgcgtccggtgggcgta
tggttcaacgttctggctgaagacacctggcgtctggtgctgggcgattcctatcagtac
ctgaaccagcgctaccagagcgagctgtacagcttctatggcaaagcgatcagcaagcgc
tatccgttcgacgcgcacagcgccagcgatgtggcaatcagcgacttccgtgagttcttc
aaggctcagggcattgccgatcgcttcttcgataactacatgcgtccgttcgtgagtggc
gatgcaggcaactatcgcatgcgtagcgtcgatggctacagcctgccggtttccaaggtc
tatctcgaccagatggccgcggcactggtgatccgccaaagcttcttcgccgacaacccg
gccgagccgcaggtgcagttcaagctggagccttacacacttgacccggctgtcagccgc
tccgagttcaagtttggcgacaagaccattgaataccgtcacggtccgatcgtaccggtg
tccttcaaatggcctacagatgcggaagacggccgcaccagcctggtactcgacagaatg
gtgggtcgtccgctgggtcttgagaagaataccggcccatggtcgctgttccgtctgttc
gacctgatgcagaccgaatacctgaccggacgtgacgtgttggtgctcaaggctgacgtg
ggtggtctgcgcgccaactacctgttgaccagccagcgtacgccgaacccgtttgacatg
ggcgcactgcgtaccttccgcatgccggggcagctttga

DBGET integrated database retrieval system