KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5420Help
Entry
PSPTO_5420        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pst00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPTO_5420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTO_5420
Secretion system [BR:pst02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPTO_5420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-GeneID: 1187107
NCBI-ProteinID: NP_795147
UniProt: Q87U87
Position
complement(6161765..6163096)
Genome map
AA seq 443 aa AA seqDB search
MKSHKVIWQEGMLLRPQHFQHNDRYYDHQMKTRTQLLGSYTWGFLSLDIDLQFLNMGKLV
ISHASGILPDGSLFELGGNTEPLALDVPPNTGNTPIYLALPLVTGNHIESRRPEQSDVLA
RYTAYEAEVSDSNAGDDSSSQVSCGRPDFKLLLGQQQSDQAYVKLKVCEVLDTTPDGVIS
LDPDFVPTYIQAHASSYLLSCLKEVISMLSHRGDTIADRIRSNGKVGGAEVGDFMMLQLI
NRTELLLRHYLDLEQVHPEELYRTLLTMLGDLATFSSDSKRPRLDSRYQHSDQGASFRKL
MEAIRQVLSMVLEQHAIELVLQARQYGIIVSPLHDHKLLGSASFVLAASANCDSEELRHR
LPAHLKVGPVERIRQLVNLHLPGIKVKPLPVAPRQIAFHTNKTYFILELSSEDLAQLERS
GGFAFHVSGEFAELELKFWAIRN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcccataaagtcatttggcaggaaggcatgttgctgcgcccgcagcacttccag
cacaacgatcgctactacgatcaccagatgaaaacccgtacccagttattggggagctac
acgtggggttttctgagtctggacatcgacctgcagtttctcaatatgggcaaactggtg
atcagccatgcgtcgggaatcctgccggatggcagcctgttcgagttggggggcaacact
gagccgctggcgctcgatgtgccgcccaatacgggtaatactccgatctatctcgcgctg
ccgctggtcacgggtaaccacattgagtcgcgccgccccgagcaatctgatgtgctggcg
cgctataccgcctacgaggctgaggtgtccgactccaacgctggcgatgactcctcgagt
caggtcagttgtggtcgtcccgacttcaagctgttgcttggccagcagcaaagcgatcag
gcttacgtgaagctgaaggtttgcgaagtactcgacacgacgccggatggcgtaatcagc
cttgatcccgattttgtaccgacctacatacaggctcacgcttccagctacctgctgtct
tgcctcaaggaagtcatcagcatgctcagccaccggggcgacaccatcgctgaccggatc
cgttccaacggcaaggtagggggtgccgaagtcggcgacttcatgatgctgcaactgatc
aaccgtaccgagttgctgctgcgtcactatctggaccttgaacaggtgcaccctgaagag
ttgtatcgcacgctgctgaccatgcttggcgatctggcgacgttttcgagcgatagcaag
agaccgcgtctggacagccgctaccagcacagcgatcagggagccagcttccgcaagctg
atggaggcgatccgtcaggtgctgtcgatggtgctggaacagcacgccatcgaactggtt
ctacaggcgcgtcagtacggcatcatcgtatcgcctctgcatgatcacaagctgttggga
tcggcgtcgttcgttctggcagccagcgcaaattgcgactccgaggaactgcgtcaccgt
ttgccagcgcacctcaaggtcggtcctgtggagcgtatccgccaactggtcaaccttcat
ctgcctggtatcaaggtcaagccattaccggtggccccgcggcagattgcgttccatacc
aacaaaacctatttcatcctcgaactcagttccgaagatctggcgcaactcgagcgctcc
ggcggcttcgcgttccatgtgtccggcgaattcgccgagcttgaactgaaattctgggct
atcaggaactga

DBGET integrated database retrieval system