KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5436Help
Entry
PSPTO_5436        CDS       T00118                                 

Definition
(RefSeq) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pst00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPTO_5436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTO_5436
Secretion system [BR:pst02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPTO_5436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 Phage_base_V
Motif
Other DBs
NCBI-GeneID: 1187123
NCBI-ProteinID: NP_795163
UniProt: Q87U72
Position
6181756..6183798
Genome map
AA seq 680 aa AA seqDB search
MFAPANQTHFSLTIEGLSNDLQVLALQGREAISQPFAFEVDLVSEQPSLDLETLLHKPAF
LQLSPDGSGIHGQIYRASQGDSGKRLTRYAVTLRPQLAYLAHRTNQRIFQNLTVPKIIGI
VLEEHGIQGNAYEFKVGSIYPERIYCVQYDESDLHFVQRLCEEEGIHYHFQHSTNGHTLV
FGDDQTVFPKLAPVAYQQDSGMVATDPVVKRFDLRMETRTSRTTRRDYDFEKPRLTLESE
NRGDAIPDLEDYDYPGRFVDRERGKQLAKRALERHRSDYQLAVGKSDQPLLVSGHFLALT
QHPKAKWNDLWLLTEILHEGKQPQVLEESVTSDTTDLKDDFHQGYRNRFQATPWDVPNRP
PLTHPKPRILGSQSAVVTGPKGEEIHCDQYGRVKVQFPWDREGQSDDKTSCWLRVSSAWA
GAMYGGIAIPRIGMEVLVTFLEGDPDQPLISGCLYHKENVVPYDLPANKTRSTFKSMSSP
GGGGFNELRIEDKKGQEQIFLHAQRDWDENVENDQKIRVGNERHDTVEQNSHSEFKAEEH
HTVYADRKVEARADDHLTVGANQHVKVGTGQFIEAGQEIHLSSGVKVVLEAGSELTLKAG
GSFIKIDASGVTLSGPFIHVNDGGSPGNGTPAAPLMPGPLLQADADKAGAALTPAQINTL
KRNAPFCEECEKCKDGACAI
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgccggccaatcagactcacttttccctgaccatagaaggtctttccaatgat
ctgcaggttcttgccttgcaaggtcgggaagccatcagccagccttttgcgtttgaggtc
gatctggtcagtgagcagccatccctggacctcgaaacgctgctacataaaccggccttt
ctgcagctctcgcctgacggcagcggcattcatggccagatttaccgcgcctcacagggc
gactcgggcaagcggctaacccgctacgccgtgaccttacgcccgcaactggcctacctt
gcccaccgtaccaaccagcgtatcttccagaacctcaccgtcccgaaaatcatcggtatt
gttctcgaagagcacggcattcaaggcaacgcctacgaattcaaagtcgggtcgatttat
cctgaacgcatctactgcgttcaatacgatgaatcggatctgcacttcgtccaacggctg
tgcgaggaagaaggtatccactaccatttccagcacagcaccaacggccacacactggtg
ttcggcgatgaccagacggtgttcccgaaacttgcaccagtggcctaccagcaagactca
ggcatggtcgccaccgatccggtggtaaagcgattcgacctgcgcatggaaacccgcact
agccgcacgacacgccgcgactacgacttcgagaaaccgcgcctgacgctggaaagcgaa
aaccggggcgatgccatccccgaccttgaagactacgactaccctggccgcttcgtggat
cgcgaacgcggcaagcaactggccaaaagagcactggaacgtcatcgcagcgactaccaa
ctggccgtaggcaagagcgatcagccgctgctggtcagcggccactttctggcgctgacc
cagcaccccaaagccaaatggaacgatctgtggctgctgaccgaaatcctgcacgaaggc
aaacagccgcaggtgctggaggagtcggtcaccagcgacacaaccgacctgaaggatgat
ttccatcagggctaccgcaaccgcttccaggccaccccgtgggacgtgcccaaccgtccg
ccgctgacccaccccaaaccgcgcattctcggcagccaaagtgccgtggtcaccggcccc
aaaggcgaagaaatccactgcgatcagtacggccgcgtcaaagtgcagttcccctgggac
cgcgaaggccagtccgacgacaagaccagctgctggctgagggtctcctcggcctgggca
ggtgcgatgtacggcggcatcgccattccgcgcatcggcatggaagtgctggtgactttc
cttgaaggcgaccccgatcagccgctgatcagtggctgcctgtaccacaaggaaaacgtg
gttccgtacgacctgccggctaacaaaacccgcagcactttcaagtccatgagttcaccc
ggtggcggcggcttcaacgagctgcgtatcgaagacaagaaaggccaggaacagatattc
ctgcacgcccagcgcgactgggacgagaacgtcgagaacgatcagaagatacgcgtcggc
aacgaacgacacgacacagtcgagcagaacagccacagcgaattcaaggccgaagagcac
cataccgtctacgccgaccgcaaagtcgaagcacgggctgacgatcacctcaccgtaggt
gcgaaccagcacgtcaaggtcggcaccggtcagttcatcgaagcaggccaagagatccac
ctgagcagcggcgtgaaagtggtgcttgaagccggtagcgaattgacccttaaggctggg
ggcagcttcatcaagatcgacgccagcggcgtgaccctgagcggcccgttcatccacgtc
aacgacggcggtagccccggcaacggcaccccggcagccccgctgatgccgggtcctttg
ctgcaggccgatgccgacaaggccggtgcggctctaaccccggcgcagatcaacaccctc
aaacgcaacgcgccgttctgtgaagaatgcgagaagtgcaaggacggtgcgtgtgcgatc
tga

DBGET integrated database retrieval system