KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_B0064Help
Entry
PSPTO_B0064       CDS       T00118                                 

Gene name
traR-1
Definition
(RefSeq) traR protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_associated
Motif
Other DBs
NCBI-GeneID: 1187442
NCBI-ProteinID: NP_808650
UniProt: Q88BS3
Position
pDC3000B:52485..52886
Genome map
AA seq 133 aa AA seqDB search
MAMSKDVMLCAAVRLSIFKDGLRQHILKGLAAAIAANPVLAFAGAGGADIAGMGNSAAVG
AKSLQKNALTIAQFVGVVFVITGLVAAKNKKDNPQIKTGHIVGSILFGVCLAVIPEIIKR
SQAQVGLAPVDVG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttggctatgtccaaagacgtaatgctgtgcgctgctgttcgcctgtcgattttcaaagat
ggtctgcgtcaacacatattgaaaggcctggcggcagcgatagctgccaacccagtgctg
gcttttgccggtgccggcggtgccgacattgccgggatgggtaattcggcggcagtgggc
gccaagtcgttgcaaaagaatgcgctgaccattgctcagtttgtgggggtagtgtttgtg
atcactgggttggttgctgccaagaacaaaaaggacaaccctcagatcaaaactggccat
atcgtggggtccatcctgtttggcgtgtgcctggcagtgatcccggaaatcatcaagcgc
tcgcaagctcaagttggcctggcacccgtggatgtgggctaa

DBGET integrated database retrieval system