KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_B0066Help
Entry
PSPTO_B0066       CDS       T00118                                 

Gene name
traU-1
Definition
(RefSeq) traU protein
  KO
K12206  intracellular multiplication protein IcmB [EC:7.2.4.8]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTO_B0066 (traU-1)
Secretion system [BR:pst02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   PSPTO_B0066 (traU-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_GTPase NACHT AAA_10
Motif
Other DBs
NCBI-GeneID: 1187444
NCBI-ProteinID: NP_808651
UniProt: Q88BS2
Position
pDC3000B:53554..56610
Genome map
AA seq 1018 aa AA seqDB search
MPSLIRWVEDLITETSRFAVSRDLPDYCDLNTVLRLTDDDRTRHPALNAPYVLVNDDGDY
CSVYAVAGSFCDTDEAAPLEAPYSWAGRLERMMHALTAHYRRHGHKISLVFDDDPDRGRE
DVERLLAPQYASVKRTGIDLTPILDENVEKLAPWVSRERCYLVCYTGRKTLSAHELIDEN
RRIKQLIGQSPDARYGQNPVLAEMAGLKIRHDAFMSAVEAAFKDDGQGVLLELLDAHAVG
QALRSQVDRLGTSEHWYPLLPDDPITPHGVRNGDDHTPFLAPQLKFQLMNQDMETNGNKL
CVNGMWHGTLSVVLGPQTPQTFAKLKALVPRGVPWRVRMDLMPGGMKSLGMKKGTLDFMA
FVPPLRPIWNSIETLTKVEQQEPVCVMTIMASTWGDSQAAVTRHLTLLTQAFQAWGVCEV
TQTFGNPVRAWASTLVASSKGSGPNLLYPPLSEALNLLPLTRPASAWEEDGNALFATLDG
KLYPVGLATPKQNKLTSVVTGSSGQGKSVLLNKLGNVTVSSAQQRLPFMAGVDKGFSMQG
QVALLRDSLPPERKDEVVGIVLQNSPKHCRNLFDIQLGARFPIAPERNWIISMLTAMCID
PSTGNPPNERDTRQILDRVISMAYTANAEKSPRRWGRGVVPEVDTALDKSGLIERYPAQW
WDSSTWYEVRDLLFEAGFVKEAQLAQFEAVPELADMTTFLNHEDVQSAYGRVQRDGSQEL
LLEYLHRCMTDACREFKMLAGRTQFLISPRTRVIAIDLNNVMGDNTTNAGHLKTGIMFLF
AGQVAGGDFVLPQYRDELLEAVPTLYHPMHLDRLEQLDQEVKTKIYDELHNAKQVPFIFP
MLETQDREQRKFGIRTVLSSQYVSDFPDAILNSANSLYMMEVDPKDEKLLTDTIKVPKVT
LQRFQRLGSGPAADGSGVPFLGVFRIKGGGTLARILKNAMGPLELWALGSSPTDSALRRL
LYDAVGGATARAILAEAFPQGTAEKLIALRQKQAGEADSNNVIGTLANELIKRRGYNI
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcttgatccgttgggttgaagacctgatcacagaaacctcccggtttgccgta
tcacgcgatctgcccgactattgcgacttgaacacggtactgcgtctgacggacgacgat
cgcactcgccacccagccctcaatgccccgtatgtactggtcaacgacgatggcgattac
tgctcggtgtatgccgttgccggcagtttttgtgacaccgacgaagcggcacccctggag
gccccttattcctgggccggccgcttggagcgcatgatgcatgcgctgacagcccactat
cgccgacatggacacaaaatcagcctggtgttcgatgatgaccctgatcgaggccgcgag
gacgtcgaacgcctgctggcccctcagtacgcttctgtcaaaaggaccggcatcgacttg
acgccgatcctggacgaaaacgttgaaaagctggccccctgggtttcgcgcgaacgctgc
tacctggtgtgttacaccgggcgcaagacgctctcggcgcatgaactgattgacgaaaat
cgccgtatcaagcaattgatcgggcaaagcccggatgcacggtatggacaaaatccggtc
ctggctgaaatggccggcctgaaaattcgccacgacgccttcatgagcgctgtggaagct
gcctttaaagatgacggccagggtgtgctgctggaactgctcgatgcccatgcagtgggc
caggcgctgcgctctcaagtggaccggctcggtaccagtgagcattggtacccgctgctc
cctgatgatccgatcaccccgcacggtgtacgtaacggcgacgatcacacaccgtttctg
gccccgcagctgaagtttcagctgatgaaccaggacatggaaaccaacggcaacaagctc
tgcgtcaatgggatgtggcatgggaccttgtctgtagtcctggggccgcagacgccgcag
acctttgccaagctcaaagcgctggtccctcgcggcgtgccttggcgcgtacgcatggac
ctgatgcctggaggcatgaagtcgctgggcatgaaaaaaggcacgttggacttcatggcg
tttgtgccgccgcttcgccccatctggaactccatcgaaacgttgacgaaagtcgagcag
caggagccggtgtgtgtcatgacgatcatggcatcgacctggggagacagccaggccgca
gtgacgcgccatctgacgctgctgacccaggcctttcaggcctggggggtgtgcgaggtg
acgcaaaccttcggcaacccggtacgcgcatgggcctcgacgctggtggcttccagcaaa
ggcagtggcccgaacctgttgtatccgccgctttcagaggcgctgaacctgttgccgctg
acccgccctgcctcggcttgggaggaggacggcaacgccttgttcgctacgctcgatggc
aagctctatccggtcggtctggccacccccaagcagaacaagctcaccagtgtggtcacc
ggctcttccggccagggcaagtcggtgctgctgaacaagctgggcaatgtcacggtgtcc
agcgcccagcagcgattaccgttcatggcgggggtggacaaaggtttctcgatgcaaggt
caagtcgccttgctgcgcgacagtctgccgccggagcgtaaggacgaggtggtgggcatt
gtgctgcagaacagccccaagcattgccggaacctgttcgatatccagctgggcgcgcgg
tttccgatcgcccccgagcgtaactggatcatcagcatgctcacggccatgtgcattgat
ccctctaccggcaatccgccaaacgaacgcgatacccggcaaatactggaccgcgtcatc
agcatggcctataccgccaatgccgaaaaaagccccagacgctgggggcgcggggtcgtc
cccgaagtggacactgccttggataaaagcgggttgatcgagcgctatccggcccagtgg
tgggatagcagtacctggtatgaggtgcgcgatctgttgtttgaagcaggctttgttaag
gaagcgcagctggcccagttcgaagcggtgccggaactggccgacatgaccaccttcctg
aaccatgaagatgtacagagcgcctatggtcgggtgcaacgcgatggcagtcaggagctg
ttgctggagtacttgcaccgatgcatgactgacgcctgtagagaattcaagatgctggcc
gggcgtacgcagttcttgatcagtccacgcacgcgagtgatcgcgatcgatctgaacaat
gtcatgggtgataacaccaccaatgctggccacctgaaaaccggaatcatgttcctgttt
gcgggccaggtggcggggggagattttgtgttgccgcaataccgggatgagctgttggag
gcggtgcccacgctttaccaccccatgcatctcgaccgcttggagcagctggatcaggag
gtcaaaaccaagatctacgacgagctgcacaatgcgaaacaggtgcccttcatctttccc
atgctggaaacccaggaccgtgagcaacgcaaattcggcatacgcacggtgttgtcctcg
cagtacgtgagcgactttcccgacgccattctgaattcggccaactcgctgtacatgatg
gaagtggaccccaaagacgagaagcttctgaccgacaccatcaaagtgcccaaggtcact
ctgcagcgctttcagcgtttgggctcaggtccagcagcggatggcagcggcgtaccgttt
ttgggcgtgttccgaatcaagggtggcggcaccctggcgcgcattctgaaaaacgccatg
ggccccctggagctatgggcgttgggctcttcaccgaccgacagcgccctgcgcaggttg
ctatatgacgccgtcggcggtgccacggctcgcgccatcctggccgaagcctttccccag
ggcacggcagaaaaactcatcgcgctgcgccagaagcaagcgggtgaagcggattccaat
aacgtgattggcacgctggccaacgagttgatcaaacggcgcggctacaacatttga

DBGET integrated database retrieval system