KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_B0069Help
Entry
PSPTO_B0069       CDS       T00118                                 

Gene name
traY-1
Definition
(RefSeq) traY protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDK2AP Mistic
Motif
Other DBs
NCBI-GeneID: 1187447
NCBI-ProteinID: NP_808654
UniProt: Q88BR9
Position
pDC3000B:58458..60602
Genome map
AA seq 714 aa AA seqDB search
MNLLKRFWWVGLLLVFSVPAMADSVDYQTIAAAAQKPNDLSRQALVMIFGQVAVDPFAPS
QPTLIGSLFAIINGFLAVLAMFWFLTITMKTIVKAGHQGQFFAGGRSALYPIMTFGGFIM
ILPTQSGWSLAQLVMLWATSTMGIGSANLLTDKAVDMMDSGYSMVTQPTAPVTRGAARGI
FEMNLCKYAINRELQALYGDGEANTPLITTKGGNGQYDTGNGSAVCGSAKTPNTGRTGTW
NLLFDSDVDTSGVITAQHQALDTMQSTLDQAAQAFVDTYLSKRDQDVGSFQDAETQIQNA
AAAYENTVNQAINKIDFKDTLQSQLSSQIKSSGWVALGSWYHTFATANNKTNDVASSTPV
VTGMSNLGEHGTGDLYNQVFAAYKSQVQNSTYTAPLGTQTAKDDGAAATAKDPNSVFVNV
FKSPMQGLTNFFATKRVGTEADFSNQVNPLIKMQTIGDYTLGVTETLMAAYAGTWAAASS
ASNSPLGWGAKIFAVDLGAVVKDVLGALAPMFYFVMFALLAIGFSLAVFLPAVPFLFWMM
GVFNWVVSVLVGCAAGPMWAATHLGAEEDKGSRSAYGYIFLIDMMLRPSLMVLGFFFASV
AVAAGGTILNLLFASALANANADSIMGLFKMIGWLMIYARIATFGVTRLFGLQASLADYV
ISFLGGREGANLMGGMVDNMKGMFGAAGSGAQRTPGVKMQPRKPGAGGHGDGIQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcctaaaacgcttttggtgggtcggtttactgctggtcttttctgtgccggca
atggccgacagtgtggattatcagaccatcgcagcggctgcccaaaagcccaatgacctc
tcgcgccaggcgctggtgatgatttttgggcaagtagcagtcgatccatttgcaccctca
cagccaacactgattggctcactgttcgccattatcaatggctttctggctgtgctggcc
atgttctggtttctgaccatcaccatgaaaaccatcgtgaaggccgggcatcagggacag
tttttcgcaggcggtcgatctgcgctgtacccgatcatgacgttcggcggcttcatcatg
attctgcccacgcaatcgggttggtcactggcccagctggtcatgctctgggctacctct
acgatgggtattggcagtgccaatctgttgaccgataaagccgtggacatgatggacagc
ggctactcgatggtgacgcaacctacggccccggtgacccgaggcgcggcacgcggcatc
ttcgaaatgaacctgtgcaagtacgcgatcaaccgtgagctgcaagcgctttacggggac
ggcgaagccaataccccgttgattaccaccaaggggggcaacggccaatacgacaccggc
aacggcagcgcggtatgtggttctgccaaaacacccaacacgggccgcaccgggacctgg
aacctgttgtttgacagtgacgtggacacgagtggggtgatcacggcgcagcaccaagcg
ctagacaccatgcagagtaccctggatcaagcggcacaggcgttcgtagacacctacctg
agcaagcgtgaccaggacgtggggagttttcaggacgccgaaacgcagatccagaacgca
gccgccgcctatgaaaacacggtgaaccaggcgatcaacaagatcgacttcaaggacacg
ctacagagccagctttcaagccagatcaaaagcagtggttgggtggctctgggcagttgg
tatcacacctttgccacagccaataacaagaccaatgatgtggccagctcgactccggtt
gtcacggggatgagcaacctgggcgagcacggtactggcgatttgtataaccaggtgttt
gcggcctacaaatcgcaggtgcaaaacagtacctacacggctccgctagggacgcagacg
gccaaggatgatggcgcggcagcgacggcgaaggacccgaattcggtgtttgtaaacgtt
ttcaaatcgcccatgcaggggcttaccaatttttttgccactaagcgcgtcggtaccgag
gcagacttttcgaaccaagtgaacccgcttatcaagatgcaaacaattggtgactacacg
ttaggagttacagaaacacttatggctgcctatgccggaacttgggccgccgcctcatcg
gccagcaactcgccgttgggctggggggccaaaatatttgcggtagatttaggggcggtt
gtgaaagacgtgctgggcgcgcttgcaccgatgttttatttcgtcatgttcgccctgctg
gccatcggtttttcgctggccgtatttctgcctgctgtgcccttcctgttctggatgatg
ggggtattcaactgggtcgtcagtgtgctggtgggatgtgcggctgggccgatgtgggct
gcgacgcacttgggcgcagaggaagacaagggcagccgtagtgcctacggttatatcttc
ctgatcgacatgatgctgcggccgtcgttgatggtactggggttctttttcgcttcggtg
gccgtagccgcagggggaacgatcctgaatctgttattcgcctcggcgctggccaatgcc
aacgcagactcgataatggggctgttcaagatgattgggtggctgatgatctatgcccgc
attgcgacctttggtgtgactcggctctttggcctgcaggcgtccctggcggactacgtg
atctcgtttctaggaggccgagaaggggcaaacctgatgggcggcatggtcgataacatg
aaaggcatgtttggtgctgctggctctggggcacaacgtacccctggcgttaaaatgcaa
cctaggaagcctggcgcaggggggcatggggatggaattcaatag

DBGET integrated database retrieval system