KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_B0075
Entry
PSPTO_B0075       CDS       T00118                                 

Definition
(RefSeq) trbB protein, putative
  KO
K12228  TrbB protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Brite
KEGG Orthology (KO) [BR:pst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pst02044]
    PSPTO_B0075
Secretion system [BR:pst02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   PSPTO_B0075
SSDB
Motif
Pfam: Thioredoxin_2
Other DBs
NCBI-GeneID: 1187453
NCBI-ProteinID: NP_808660
UniProt: Q88BR3
Position
pDC3000B:63546..64631
AA seq 361 aa
MASASLRAPFSVDIQGDQLVVYQADQEAGIVTRTICTLDLRHQHSFYLSNDGVVCRDVQG
FEFSLETHDSNETHELLTALSRALLRHGRRKTQRRLMGVFVLLVVLCLGAPWLGRALELP
VVMPAAQVITPSVTSPPKPDLAKRSAPAPIASEPRQSAADVAPDDGWTLPREVRATLPQK
LHNAAERKLFTVDYSSGHARTLYVFSDPGCPNCQRLESSLNTLSDAFNVVVFPVPVIGKE
KSIAAITPVLCLPPEQRKTPWDRLFDAAPEGVNLGKPPLKPASEGVELKAAQPAGTCDVA
EKALGINQTAYQAYRIPGTPWVISDDGRYVPQALLRDPIRLKAFLDERPARQVQEVSNAP
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcctcggcatctttacgcgccccgttttcggtggacatccaaggcgatcagctggtt
gtctatcaggcagatcaggaagcaggcatcgtgacacgcacgatttgcaccctggacctt
cgccatcagcactcgttttatttgagcaatgacggtgtggtctgccgcgatgttcagggt
tttgaattctcacttgaaacccatgacagtaacgaaacccatgagctactgaccgcactg
tcgcgggctttgctgcgtcatggacgacgcaagacccagcggcgtctgatgggcgtgttc
gtgctgttggttgtgctttgcctcggtgccccatggcttggccgagcgcttgaattgcct
gttgtaatgccggcggcgcaggtcatcacgccctcagtcacgagcccccccaagccggac
ctggccaagcgcagcgcgccggcgccgatcgcttctgagccacgccagtccgctgcagac
gtggcacctgacgatggctggacattgcccagggaggttcgggccacactccctcaaaag
ctgcacaacgctgccgagcgcaagctgttcaccgttgactattccagcggtcacgcgcgc
acgctgtatgtcttttcggaccctggctgcccgaactgccagcgtctggagtcgtccctc
aacacgctctccgacgccttcaacgtggtggtgtttcctgtgccggtgattggtaaggaa
aagtcgatcgccgccattacgccggtgctgtgcctgccgcctgagcagcgcaaaaccccg
tgggatcgcctgtttgatgcagcccctgagggtgtgaaccttgggaaacccccgttaaag
ccggcgtcggaaggggtggagttgaaagcggcgcaaccagcaggcacgtgcgatgttgca
gaaaaggccttggggatcaaccagacggcctatcaggcgtatcgcataccgggcacgccc
tgggtgatcagcgacgatgggcgctatgtgccgcaggcgttgttgcgtgatccgatcagg
ctcaaagccttcctagatgagcgacctgcccgccaggttcaggaggtgtcgaatgcgccc
caatga

DBGET integrated database retrieval system