KEGG   Providencia stuartii BE2467: BGK56_06150Help
Entry
BGK56_06150       CDS       T04734                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00860  Porphyrin and chlorophyll metabolism
psta00970  Aminoacyl-tRNA biosynthesis
psta01100  Metabolic pathways
psta01110  Biosynthesis of secondary metabolites
psta01120  Microbial metabolism in diverse environments
Module
psta_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
psta_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BGK56_06150
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BGK56_06150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psta01007]
    BGK56_06150
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psta03016]
    BGK56_06150
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:psta02048]
    BGK56_06150
Enzymes [BR:psta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BGK56_06150
Amino acid related enzymes [BR:psta01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BGK56_06150
Transfer RNA biogenesis [BR:psta03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BGK56_06150
 Prokaryotic Type
   Other AARSs
    BGK56_06150
Prokaryotic defense system [BR:psta02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BGK56_06150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: APG50547
UniProt: A0A379H3C4
Position
1297507..1298928
Genome map
AA seq 473 aa AA seqDB search
MSKIKTRFAPSPTGYLHVGGARTALYSWLFSRHNQGEFVLRIEDTDLERSTQEAIDAIMD
GMNWLNLNWDEGPYYQTKRFDRYNDVIDQMLEAGTAYRCYCSKERLEALRDQQMASGEKP
RYDGCCRDHAHNHTPDEPHVVRFRNPQEGSVIFDDKIRGPIEFSNQELDDLIIRRTDGSP
TYNFCVVIDDWDMEITHVIRGEDHINNTPRQINILKALGAPVPEYAHVSMILGDDGKKLS
KRHGAVSVMQYRDEGYLPEALLNYLVRLGWSHGDQEIFSREEMIEYFSLDAISKSASAFN
TDKLLWLNHHYINQLPPEEVAVHLAWHIEQQNINTENGPQLAELVKLLGERCKTLKEIAE
SCRYFYEEFDEFDADAAKKHLRPVARQPLETVKQKLSAITDWTAENVHQAIEQTAAELDV
GMGKVGMPLRVAVTGAGQSPALDVTVHAIGQTRAIARIDKALSFIAEREASAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaaaacccgttttgcacctagtccaacagggtatttacatgttggtgga
gcgcgtactgcgctttattcctggttattcagccgccataatcaaggcgaatttgttctg
cgtatcgaagatacggacttagaacgctcaactcaggaagctatcgatgccattatggat
ggtatgaactggttaaatttgaattgggatgaaggcccttattatcaaacgaaacgcttt
gaccgttataacgatgttattgaccaaatgcttgaagcaggtaccgcttatcgttgctac
tgctcaaaagagcgcttagaggcgctgcgtgatcaacagatggcatcaggtgaaaagcct
cgctatgatggctgctgccgtgatcacgcccataaccatacgcctgacgagccgcatgtt
gttcgtttccgtaatccacaagaaggctcggttatttttgatgataaaatccgtggcccg
attgagtttagtaatcaagagttagatgacctcattattcgccgcaccgatggctcacca
acttataacttctgtgtggttattgatgactgggatatggaaattactcacgttatccgc
ggtgaagatcatatcaacaataccccacgccaaattaatatcttaaaagcgctaggagca
cctgttcctgaatatgcacacgtttcaatgattttaggcgatgacggtaaaaaactctcc
aagcgtcacggtgctgtaagcgttatgcaatatcgcgacgaagggtatttaccagaagca
ctactcaactatttagttcgtttgggctggtcacatggcgaccaagagattttttctcgt
gaagaaatgattgaatactttagcttagatgcaattagcaaatcagcgagcgcattcaat
accgataagttgctttggttaaaccaccattatattaatcaattgccaccagaagaagtt
gccgttcaccttgcatggcatattgagcaacaaaacatcaacactgaaaatggcccgcaa
ttagctgagttagttaaattgctcggtgaacgctgcaaaacattgaaagagatcgctgaa
tcctgccgctacttctatgaagagtttgatgagttcgatgcagatgccgcgaaaaaacac
ttgcgccctgttgcacgtcaaccattagaaacggtgaaacaaaaactgtcagcaattacc
gattggacagcagaaaacgttcatcaagctatcgaacaaacggccgctgaattagacgtt
ggtatgggtaaggtcggcatgccattacgtgtcgctgtaactggtgcgggtcaatcccct
gcgttagatgttaccgttcatgcgattggtcaaacacgtgctattgcacgcattgataaa
gcgttgtcgtttatcgccgaacgtgaagcctcagcccagtaa

DBGET integrated database retrieval system