KEGG   Providencia stuartii BE2467: BGK56_17790Help
Entry
BGK56_17790       CDS       T04734                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
psta  Providencia stuartii BE2467
Brite
KEGG Orthology (KO) [BR:psta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psta03016]
    BGK56_17790
Enzymes [BR:psta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BGK56_17790
Transfer RNA biogenesis [BR:psta03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BGK56_17790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: APG52692
UniProt: A0A379GXN0
Position
3871898..3872656
Genome map
AA seq 252 aa AA seqDB search
MLEIIYQDEYMVAVNKPAGMLVHRSWLDSKETVFVMQTLRDQIGQFVYPIHRLDRPTSGV
LLFALSSDVARQLAAQFESHQIEKIYHAVVRGYVEAPQTIDYPLLEQLDKIADKHATREP
ALQECVTHCQPIAQVECSVAIGRYPTSRFSLLELKPETGRKHQLRRHMSHIRHPIIGDSK
HGDLRQNRGVSQHFAVSRLMLHASQLVLDHPISGERISLIAQWDESWLSLVNQFGWQHIA
SKLGMGEFNSSL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttagagattatttatcaagatgagtatatggttgctgttaataagcctgccggtatg
ttggtgcatcgcagctggttagacagcaaggaaactgtgtttgttatgcaaacattacga
gaccaaattggtcaatttgtttatccaatccatcgtcttgataggccaacatcgggtgtg
ttgttgtttgcactatccagtgatgtggcgaggcaattagcggcgcagtttgaatctcat
caaatagaaaaaatctaccatgcggtggttcgtggctatgttgaagcgcctcaaaccatt
gattatccattacttgagcagttggacaaaattgcggataaacatgcgaccagagagcca
gcattgcaagagtgtgttacacattgccagccaatcgctcaagttgagtgctcagtcgca
attgggcgttatccaacatctcggtttagtttactagaattgaaaccagaaacagggcgc
aaacatcagttacgacgtcatatgtcgcacattcgtcaccccattattggcgatagtaaa
cacggtgatttacgtcaaaaccgcggtgtaagccaacattttgccgtttcacggctaatg
ttgcatgccagccagctagtattagatcatcccatttcaggggagcgtatctctctgatt
gcacaatgggatgagtcatggttgtcattggtaaatcagtttgggtggcagcatatcgcc
agcaaattgggaatgggagaattcaattcatcactgtag

DBGET integrated database retrieval system