KEGG   Providencia stuartii BE2467: BGK56_19830Help
Entry
BGK56_19830       CDS       T04734                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
psta  Providencia stuartii BE2467
Pathway
psta00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:psta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BGK56_19830
Enzymes [BR:psta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BGK56_19830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: APG53061
UniProt: A0A379GZ77
Position
4323184..4323735
Genome map
AA seq 183 aa AA seqDB search
MNKAHYRQQVVNFLEKAHIRLTEEEKARIEIASFGLPDYPRSGLQLLTYCNSERYCAKEL
VLFPHQVCPEHRHPPFGSSMGKQETFRCRWGEVYLFVDDDSLTLNKNESGEPICPKPEGD
EQWYQCDRFILLKPGEQYTIKPNTLHWFKAGSMGAVVSEFSSESRDEFDIFTDPRVRRLE
GVE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcacactatcggcagcaagtcgttaattttctggaaaaagcacatatccgt
ctcacagaagaagaaaaagcacgaattgagatcgccagttttggattaccagactatcca
cgttcaggcttacaactgttaacttattgtaatagcgaacgttattgtgctaaagagttg
gtgctgtttccccatcaggtttgccctgagcatcggcatccaccgtttggctcttcaatg
ggtaagcaagaaacttttcgttgtcggtggggggaagtatacctatttgttgatgatgat
tcgttaacattgaataaaaatgaatcgggggaaccgatttgccctaaaccagaaggtgat
gagcagtggtatcagtgtgaccgctttattttactcaaaccgggagagcagtatacgata
aaacctaatacattacattggtttaaagctggcagtatgggagcggttgtttctgagttc
tcaagtgaaagtcgtgatgaatttgatatttttaccgacccaagagtacgacgtttagaa
ggggtcgaataa

DBGET integrated database retrieval system