KEGG   Paenibacillus stellifer: PSTEL_02240Help
Entry
PSTEL_02240       CDS       T03335                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pste  Paenibacillus stellifer
Pathway
pste00020  Citrate cycle (TCA cycle)
pste00310  Lysine degradation
pste00380  Tryptophan metabolism
pste01100  Metabolic pathways
pste01110  Biosynthesis of secondary metabolites
pste01120  Microbial metabolism in diverse environments
pste01130  Biosynthesis of antibiotics
pste01200  Carbon metabolism
Module
pste_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pste_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTEL_02240
  09105 Amino acid metabolism
   00310 Lysine degradation
    PSTEL_02240
   00380 Tryptophan metabolism
    PSTEL_02240
Enzymes [BR:pste01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSTEL_02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N HlyD_3 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AIQ62115
UniProt: A0A089LPT6
Position
complement(447057..448370)
Genome map
AA seq 437 aa AA seqDB search
MSEIKVPDLGESITEGTIYKWLVKEGDSVGQGDVLAELETDKVNLEISAEESGVIAQILR
QAGENVAVGEAIGIIGEAGAGAAGQAAAGGQSADAPKLPEPAKAAPAPEAPPAQPGGATA
AAAAQEAQAAGGSAYLATPGARKLARERGIDLGEVGARDPIGRIGRADVDTHGAAPAAAP
APATAAAQSAPAVTPPPSAPKAEGKEVERKRMSRRRLTIASRLVEAQQTAAMLTTFNEVD
MTAILDIRKRRKDAFKEKHDIGLGFMSFFTKAVVGALKAYPLLNAEIDGEDLLIKKFYDI
GIAVSAKEGLVVPVVRDADRLSFPEIERRIADLASKARANTLALSDLQGGTFTITNGGVF
GSLMSTPILNAPQVGILGMHKIQLRPIALDEETTVNRPMMYIALSYDHRIVDGSEAVSFL
VKVKELLEDPEALLLEG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaaatcaaagtgcccgatctgggcgaatcgattactgaaggtacgatctataaa
tggctggtcaaggaaggagattccgtcggtcagggagatgttctggctgagcttgagacg
gataaggtcaatctggagatcagcgccgaagagagcggcgtgatcgcccaaattctgcgc
caggcgggcgagaacgtcgccgtcggcgaagccatcggcatcatcggcgaagccggagcc
ggagccgccggacaggcggcggctggcggccagagcgccgatgcgccgaagctgccggag
ccggcgaaggccgctccggcccccgaagctccgccggcacagcctggcggagcgacagcc
gcggcggcggcccaggaggcccaggccgccggcggttccgcgtacctggctacgccgggt
gcgcgcaagctcgcgcgcgagcgaggcatcgacctcggcgaggtcggcgcgcgcgatccc
atcggccggattggccgggccgatgtggacacccacggcgcggccccggccgccgcgccg
gcaccggcaacggcggctgcgcagagcgcgccggccgtgacgcccccgccctccgcgccg
aaggcggagggcaaggaagtcgagcgcaagcgcatgtcgcgccggcggctgacgatcgcg
agccgcctggtcgaagcgcagcagacggcggcgatgctgaccaccttcaacgaggtggac
atgacagccattctcgacatccgcaagcgccggaaggatgccttcaaggagaagcatgac
atcggcctcggcttcatgtccttcttcaccaaggcggttgtgggcgcgctcaaggcctac
ccgctgctgaacgccgagattgacggcgaggatctgctcatcaagaaattttacgacatc
ggcatcgccgtatcggccaaggaaggcctcgtcgttccggttgtgcgggacgccgaccgg
ctgagcttcccggagatcgagcgcagaatcgccgatctggcgtcgaaggcccgggccaac
acgctcgcgctgtccgatctccagggcggcacattcaccattaccaatggcggcgtattc
ggctccctgatgtcgacgccgattctgaacgcgccgcaagtcggcatactgggcatgcac
aagattcagcttcgtccgatcgcgctcgatgaagagacgacagtcaaccgaccgatgatg
tatatcgccctctcctacgatcaccggatcgtggacggctcggaggcagtcagcttcctt
gtcaaagtcaaggaactgctggaagacccggaggcgctgctgctggaaggctaa

DBGET integrated database retrieval system