KEGG   Paenibacillus stellifer: PSTEL_04045Help
Entry
PSTEL_04045       CDS       T03335                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pste  Paenibacillus stellifer
Brite
KEGG Orthology (KO) [BR:pste00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PSTEL_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIQ62398
UniProt: A0A089LT91
Position
816232..817221
Genome map
AA seq 329 aa AA seqDB search
MDTSLFVLGIVIVLALGFDFINGFHDTANAIATSVSTRALPPRTAIIMAACMNFVGAMLF
TGVAKKIGGSVTDPTKLDNGIEVVIATLLAAIIWNLLTWWFGIPSSSSHALIGALAGAVY
VGAGSDHIKWSGFTEIVEGLIFSPIIAFVIGYIVMTILKWIFARRSPHTVNKGFRTMQIL
TAAFQSFTHGTNDAQKAMGIITFALVTSGHLGSMEVPLWVKICAATSMALGTSIGGWKII
KTMGTKIFKIEPINGFAADISAASVIFSATLLHLPVSTTHAITSAILGVGSAKRFSAVKW
GIAGRIVITWFITIPISAVLAGVIFKILF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatacatctttatttgtgctaggtattgttatagtacttgcactcggattcgacttt
atcaacggattccatgatacggcgaacgccatcgcgacctcggtatcgacccgggccctt
ccgccccggacggccatcattatggcggcgtgcatgaacttcgtcggcgcgatgctcttt
acgggggtagcgaagaagatcgggggcagcgtaaccgaccccacgaagctggacaacggg
atcgaagtggttatcgccactctgctcgccgcgatcatctggaacctgctcacctggtgg
ttcggcattccgtcgtcgtcttcccatgccctgatcggagcgcttgccggtgcggtgtat
gttggagccggctccgatcatatcaaatggtccggattcacggaaattgtggaaggactt
atcttctcgccaattattgctttcgttatcggctacatcgtcatgacgatactcaaatgg
atcttcgcaaggcgaagtccgcataccgtcaacaaaggcttccgtacgatgcagattctg
acggccgccttccagtcattcacgcacggaacgaatgatgcacagaaagcgatgggtatt
atcaccttcgcgctggtcacctccggccacctcggctcaatggaagttccgctgtgggtc
aaaatttgtgcggcgacatccatggcgctcggaacatcgatcggcggctggaagatcatc
aagacgatgggcacgaagattttcaaaatcgaaccgatcaacggcttcgccgccgatata
tcggcagcctcggttattttctcggcgacgcttctgcatctgccggtcagtacgacccat
gccattacatcggcaattctgggcgtaggctcggccaagcgtttctccgcagtgaagtgg
ggaatagcgggccggattgtcatcacctggttcatcacgatcccgatcagcgccgtgctg
gcgggagtcatcttcaaaattttgttctaa

DBGET integrated database retrieval system