KEGG   Paenibacillus stellifer: PSTEL_05215Help
Entry
PSTEL_05215       CDS       T03335                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pste  Paenibacillus stellifer
Pathway
pste00010  Glycolysis / Gluconeogenesis
pste00053  Ascorbate and aldarate metabolism
pste00071  Fatty acid degradation
pste00280  Valine, leucine and isoleucine degradation
pste00310  Lysine degradation
pste00330  Arginine and proline metabolism
pste00340  Histidine metabolism
pste00380  Tryptophan metabolism
pste00410  beta-Alanine metabolism
pste00561  Glycerolipid metabolism
pste00620  Pyruvate metabolism
pste00625  Chloroalkane and chloroalkene degradation
pste01100  Metabolic pathways
pste01110  Biosynthesis of secondary metabolites
pste01120  Microbial metabolism in diverse environments
pste01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTEL_05215
   00053 Ascorbate and aldarate metabolism
    PSTEL_05215
   00620 Pyruvate metabolism
    PSTEL_05215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSTEL_05215
   00561 Glycerolipid metabolism
    PSTEL_05215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTEL_05215
   00310 Lysine degradation
    PSTEL_05215
   00330 Arginine and proline metabolism
    PSTEL_05215
   00340 Histidine metabolism
    PSTEL_05215
   00380 Tryptophan metabolism
    PSTEL_05215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSTEL_05215
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSTEL_05215
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSTEL_05215
Enzymes [BR:pste01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PSTEL_05215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIQ62591
UniProt: A0A089LM28
Position
1074415..1075791
Genome map
AA seq 458 aa AA seqDB search
MEQWTSEQVDQILQEHRKKFNTGYTRDVNFRLEQLGKLADAIRRNEQQLLSALYEDLHKN
EFEAYSTEIGYTLDSIRYMRSNLKRWVKPQKVKTPFYHVPSTSRMYKEPYGTVLIIGPFN
YPFQLLIEPLIGAIAAGNSVILKPSENTPTVAAAVRKLIRDTFDETYIRVIEGEKETTSA
LINAPFDYIFFTGSVPVGKIVMEAAARNLVPVTLELGGKSPAIVDKTANIGVAAKRIIWG
KMMNAGQTCIAPDYVLAHEDIRAELIEKMKTALTSFYGPDARQSGDFGRIVNERQFDRLA
SILESDQEHVLFGGKKIREELYIEPTLLDTVSWSDAAMQDEIFGPILPIMGYSQLEEVIE
TVNSRPKPLALYLFSEQRHVQEEVLARVPFGGGCVNDTISHVANHHLPFGGVGHAGIGAY
HGKFSFDQFSHTKSVMTKSTRMDISFLFPPYRDKVKCC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtggacatctgaacaggttgatcaaattctgcaagagcatcgcaagaaattc
aacactggctatacacgggatgtaaacttccggctggagcagcttgggaagctggcggat
gcgatcagaaggaatgagcagcaattgctgtcggctttatatgaggatctgcacaaaaat
gaattcgaagcctactcgacggagatcggctatacgctggacagcataaggtacatgaga
agtaacttgaagcgatgggtgaaaccgcaaaaggtaaaaaccccgttctatcatgtgccc
tcgacaagccgcatgtataaagagccttatggaactgtcctcattatcggaccgtttaat
tatccgttccaattgctgattgagcctctgatcggcgccattgcggcagggaacagcgtg
atcctgaagccttccgagaatacgcccacggttgccgccgccgtcaggaagctgatccgg
gacacctttgatgagacttacattcgggtgatcgaaggagagaaggagacaacctcggcg
ctgattaacgccccgttcgattacatctttttcacaggaagcgtgcctgtcggcaaaatc
gtcatggaagccgcggcgcggaacctcgttcccgtcacccttgagcttggagggaagagt
cctgccattgtggacaagactgcgaatatcggggttgcagccaagaggattatttgggga
aagatgatgaacgctggccagacatgcatagccccggattatgtactggcgcatgaggat
atccgagcggagctaatcgagaagatgaagacggctcttacaagcttctacggaccggat
gcgcggcagagcggggattttggccggatcgtcaatgaacgccagttcgaccggctcgcc
tccattttggaaagtgaccaggagcatgtgctgttcggcggcaagaagatcagagaggag
ctgtacatcgagccgacgctgcttgacacggtttcctggagtgacgctgccatgcaggac
gaaattttcggaccgattttgccgatcatgggctacagccaactggaggaagttattgag
acggtgaacagccgcccgaagccgcttgcgttatacctgttcagcgaacagcgccatgtc
caagaggaagtgcttgcccgcgtaccgttcggcggaggctgtgtgaacgatacgatcagc
catgttgccaatcaccatctgcccttcgggggagtcggccacgccgggatcggcgcctac
catgggaaattcagcttcgaccagttctcccatacgaagagtgtgatgaccaagagcacc
agaatggacatttctttcttatttccgccctatcgggacaaggtgaagtgctgttag

DBGET integrated database retrieval system