KEGG   Paenibacillus stellifer: PSTEL_21310Help
Entry
PSTEL_21310       CDS       T03335                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pste  Paenibacillus stellifer
Pathway
pste00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pste00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PSTEL_21310
Enzymes [BR:pste01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PSTEL_21310
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PSTEL_21310
    1.1.1.-  
     PSTEL_21310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N Shikimate_DH ADH_N_assoc Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIQ65283
UniProt: A0A089M1A2
Position
4452235..4453287
Genome map
AA seq 350 aa AA seqDB search
MQALRWHNVKDLRVETIDEPKVLPGKVKIRVEWCGICGSDLHEYVAGPIFIPKDKAHPLT
GEAAPIVMGHEFSGEIVEVGEDVNQFKVGDRVVVEPIFACGTCEACRQGKYNLCDKMGFL
GLAGGGGGFSEYVSVNANMVFKIPDSLSFEQGALVEPSAVALHAVRQSQLKVGDKAAVFG
AGPIGLLVIEALRASGAAEVYVIELSEERKQKAIELGAVVLDPRECDVVKELHDRTYGGV
DVAYEVTGVPSVLSQSINSTKLGGQVMIVSIFEKDAPITPNNIVLKERNMTGIIGYRHVF
PAVLSLMEQGYFPADKLVTKKIKLDEVIEQGFEALLKERNQVKILVSPRP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcattgagatggcataatgtgaaagacttgagagtggagacaatcgatgagccg
aaggtccttcccggaaaggtcaaaatccgtgtggaatggtgcggaatttgcggcagcgac
cttcacgaatatgtggcgggtccgatctttatcccgaaggataaagcccatccgttgacc
ggagaagccgctccaatcgttatgggccatgaattctcgggtgaaattgtcgaagtcggc
gaagacgtgaaccagttcaaggtcggcgaccgggttgttgttgagccgatctttgcatgc
ggtacttgcgaggcgtgcagacagggcaaatataatctctgtgacaaaatgggcttcctc
ggactggccggaggcgggggcggtttttccgaatacgtttccgtaaatgctaatatggtt
ttcaaaattccggattccttgtccttcgagcagggcgctctggtcgagccgtccgctgtc
gcgcttcatgccgtccgtcaaagccagctgaaggtcggcgacaaagccgccgtgttcggc
gcaggaccgatcgggctgctggtcatcgaggcattgagagcctcgggcgccgccgaggtc
tatgttatcgagctgtccgaggaacgcaagcagaaggcgatagaactaggcgccgtcgtc
ttggacccgagagaatgcgatgttgtgaaggagctgcatgaccgtacttacggcggtgtc
gatgtcgcgtacgaggtaacgggcgttccgtccgtgctgtcgcaatcgatcaactctacc
aaactgggcggccaggtgatgatcgtcagtatttttgaaaaagacgctccgatcaccccg
aacaatatcgtgctgaaggaacgcaacatgacaggcattatcggctaccgccacgtattc
cctgccgttcttagcctgatggaacagggctatttcccggcggacaagcttgtgacgaag
aagatcaagctggacgaagtgatcgagcagggcttcgaggctctgctgaaagagagaaat
caggtcaaaatcctcgtctcgccaagaccttaa

DBGET integrated database retrieval system