KEGG   Phreatobacter stygius: E8M01_04680Help
Entry
E8M01_04680       CDS       T05955                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00260  Glycine, serine and threonine metabolism
pstg01100  Metabolic pathways
pstg01110  Biosynthesis of secondary metabolites
pstg01120  Microbial metabolism in diverse environments
pstg01130  Biosynthesis of antibiotics
pstg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E8M01_04680
Enzymes [BR:pstg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     E8M01_04680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: QCI63596
UniProt: A0A4D7B242
Position
1010102..1011166
Genome map
AA seq 354 aa AA seqDB search
MVHAPARAASGSPAVRINLYSDTQTRPTNAMKTAMMAAEVGDEQHGDDPTVHQLCDRMAA
LLGKEAAIFLPSGTMCNVVALNTHCRSGDEVLAHETAHILTSEGGSHAAIAGVQINALRG
PRGLFDAATLRAAIRPRTRYAPPQTLLEIEQTANIGGGTIWPRSTLDELTAIARNEGWAT
HMDGARLMNACVATNIRPADMCAGFDSVWLDFTKGLGAPLGAVLAGSHDFIGRAWRWKQR
LGGSMRQAGICAAACLYALDHNVERLADDHVHARALAAGLARLPGVDVAEPDTNLVFFDV
ARAGTTAAALQAALRSQGIAISLLGGRLRACTHLDVSASMIDETLGAIAGIIRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtccacgcgcccgctcgtgccgcatccggcagtcccgccgtccgcatcaatctttat
tcggacacgcagaccaggccgaccaatgccatgaagacggccatgatggcggcggaggtc
ggcgacgagcagcatggcgacgaccccaccgtccatcagctctgcgaccgcatggccgcg
ctgctcggcaaggaagccgccattttcctgccgtcgggcaccatgtgcaatgtcgtggcg
ctcaacacgcattgccgcagcggcgacgaggtgctggcccatgagaccgcccatatcctc
accagcgaaggcggcagccacgcggcgatcgccggcgtgcagatcaacgccttgcgcggc
ccgcgcggcctgttcgacgcggctacgctgcgcgccgcgatacggccacgcacgcgttat
gctccgccccagaccctgctcgagatcgagcaaaccgccaatatcggcggcggcaccatc
tggcctcgatcgacactcgacgaactgacggcgatcgcgcgcaacgagggctgggccacc
catatggacggcgcccgtctgatgaacgcctgtgtcgcgaccaacatcaggccggccgac
atgtgcgccggcttcgacagcgtctggctcgacttcaccaaggggctcggcgcgccgctc
ggcgcggtcctggccggctcgcacgatttcatcggccgggcctggcgctggaagcagcgg
cttggcgggtcgatgcggcaggccggaatttgtgccgccgcctgtctttatgccctggac
cacaatgtcgagcggctggccgacgaccatgtccatgcgcgcgcgctcgctgccggcttg
gcgcggctgccgggtgtcgatgtcgcggagcccgacaccaacctggtgttcttcgacgtc
gcccgggccggaaccaccgcggcggcgcttcaggcagccctgcgatcccagggcatcgcg
atcagcctgctcggcggacgcctgcgcgcctgcacccacctcgacgtctccgcatcgatg
atcgacgagacgctgggggcgatcgccgggatcatcaggcgctaa

DBGET integrated database retrieval system