KEGG   Phreatobacter stygius: E8M01_11790Help
Entry
E8M01_11790       CDS       T05955                                 

Gene name
sucC
Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00020  Citrate cycle (TCA cycle)
pstg00640  Propanoate metabolism
pstg00660  C5-Branched dibasic acid metabolism
pstg01100  Metabolic pathways
pstg01110  Biosynthesis of secondary metabolites
pstg01120  Microbial metabolism in diverse environments
pstg01130  Biosynthesis of antibiotics
pstg01200  Carbon metabolism
Module
pstg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pstg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E8M01_11790 (sucC)
   00640 Propanoate metabolism
    E8M01_11790 (sucC)
   00660 C5-Branched dibasic acid metabolism
    E8M01_11790 (sucC)
Enzymes [BR:pstg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     E8M01_11790 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: QCI64844
UniProt: A0A4D7ATH8
Position
2558949..2560124
Genome map
AA seq 391 aa AA seqDB search
MKIHEFQAKHLLTPYGLQAPDGAVAITAREAGDIARRLGVQHVIVKAQIHAGGRKRAGGV
QRVGSPVEAEVAASRLIGETLVTAQTGPAGQKVRRILVEAAVVAMRELHLALLVDSASGE
LMLIGSAKGGEDIEERAASGDLPLSRLKLGTGQERRTDEIAAFVTALGLDGALHAQACAL
VDGLRRAFVELDASLIEINPLAVTAGGALVALDVKMVFDDNALFRHADLAALRDEDETSA
IELQAQRHQLNYVQLDGDIGMVANGAGLGLATLDMVVAAKGRPANFMDIRTTATSLDVAH
GFRLLLDNPATRAILINVHGGGMQACDTIAEGLGIAIRRTGRRSLPLVVRLAGNNAEFAR
SRFENFGCAIIDCPDMWTAASQAVSLAAKGA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccatgagttccaggcgaaacatctcctgacgccctacggccttcaggcgccg
gacggcgccgtcgccatcaccgcacgcgaggccggcgacatcgcccggcggctcggcgtg
cagcatgtcatcgtgaaagcccagatccacgccggcggccgcaagcgggccggtggcgtc
cagcgcgtcggtagcccggtcgaagcggaagtggcggcaagccggctcatcggcgagacc
ctggtgacggcgcagaccggaccggccggccagaaggtcagacgcatcctggtcgaggcc
gcggtcgtcgcgatgcgcgaactgcaccttgccttgctggtcgattccgcctccggcgag
ctcatgctgatcggcagcgccaagggcggcgaggacatcgaggagcgcgcggcaagtggc
gacctgcccttgagccggctcaagctcggcaccggccaggagcggcgcaccgacgagatc
gccgccttcgtcacggcgctcgggctcgacggggcgctgcatgcccaagcctgcgccctg
gtcgacggcctccggcgcgcctttgtcgagctcgatgccagcctgatcgaaatcaatccg
ctggcggtcaccgcgggcggcgcgctcgtggcgctcgacgtcaagatggtgttcgacgac
aatgccctgttccgccacgccgacctggccgccttgcgcgacgaggacgagaccagcgcc
atcgagctgcaggcgcagcgccatcagctcaactatgtccagctcgacggcgacatcggc
atggtcgcgaatggcgcggggcttggccttgccaccctcgacatggtcgtcgcagccaag
ggcaggccggccaatttcatggatatccggaccaccgcgaccagcctggacgtcgcccat
ggtttccggctgctgctcgacaatccggcgacccgggcgatcctgatcaatgtccatggt
ggcggcatgcaagcctgcgacaccattgccgaggggctcggcatcgcgatcaggcgcacc
ggccgccgttccctgccgctggtggtgcggctcgccggcaacaacgccgaattcgcccgc
tcgcgcttcgagaatttcggctgcgcgatcatcgattgccccgacatgtggaccgccgca
tcgcaagcggtctcgcttgctgccaagggagcctga

DBGET integrated database retrieval system