KEGG   Phreatobacter stygius: E8M01_25800Help
Entry
E8M01_25800       CDS       T05955                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pstg  Phreatobacter stygius
Pathway
pstg00450  Selenocompound metabolism
pstg00970  Aminoacyl-tRNA biosynthesis
pstg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pstg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E8M01_25800
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E8M01_25800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pstg01007]
    E8M01_25800
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pstg03016]
    E8M01_25800
Enzymes [BR:pstg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     E8M01_25800
Amino acid related enzymes [BR:pstg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   E8M01_25800
Transfer RNA biogenesis [BR:pstg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    E8M01_25800
 Prokaryotic type
   Other AARSs
    E8M01_25800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: QCI67336
UniProt: A0A4D7BD90
Position
5458584..5460275
Genome map
AA seq 563 aa AA seqDB search
MAKALITSALPYINGVKHLGNLAGSLLPADIQARHRRQIGDRTLFICATDEHGTPAELAA
AEAGVAVADYCRRQHAAQADIYRRLNLSFDHFGRSSSPRNHALTQHFFHCLDAQGFIEER
VLQQVYSPADGRFLPDRYIIGTCPHCGFSQARGDQCESCTRPLDPVDLLAPRSALSGSTA
LEVRPTRHLFLRQSALVDELESWIGSRDGWPPLVTSIARKWLDEGIQDRCITRDLGWGVP
VPKPGFEGKVFYVWFDAPIAYIAATQDWSDADPDHRDWRAWWWQADDVEYAQFLGKDNVP
FHAVSFPCTLIGSGEPWKTVDVIKGVNWLTYEGGKFSTSQRRGLFLDQALDLLPADYWRW
WLAANAPESRDTDFSFERFATDVNNDLADTFGNLVNRVLTFTVNRHGGIVPGGGVSAEPE
ARLAAALQRQLDDLRGHHKGCALRKAAGTVRAIWRLANGYLADEAPWRSFANAPERAAVV
VRTGVNLVAAAATVAWPFIPEAADKVLRALGRSAGVPPLPQSAASALREVPSGQEVSLPP
VLFAKLTPEWVAASRARFAGGGS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctcttatcaccagcgcacttccctatatcaacggcgtcaagcacctcggc
aatctcgcgggctcgctgttgccggccgacattcaggcgcgccaccgccgtcagatcggc
gatcggacgctgttcatctgcgcgaccgacgaacatggtacgccggctgaactggcggcc
gccgaggccggcgtcgcggtcgccgactattgccggcgacagcatgccgctcaggccgac
atctatcgccggctgaacctttccttcgatcatttcggccggtcgtcgtcgccgcgcaac
cacgcgctcacccagcatttcttccattgcctggacgcgcagggtttcatcgaggagcgc
gtgctgcagcaggtctactcgccggccgatggtcgcttcctgcccgatcgctacatcatc
ggcacctgtccacattgcggcttcagccaggcccggggcgatcaatgcgaaagctgtacc
cggccgctcgatccggtcgacctgctcgcgccgcgttcggccctgtccggcagcacggcg
ctggaagtgcgcccgacccgtcacctgttcctgcgccagtcggccttggtggatgagctg
gaaagctggatcgggagccgcgacggctggccgccgctggtcacctcgatcgcccggaaa
tggctggacgaggggatccaggaccgctgcatcacccgcgacctcggctggggcgtgcct
gtgccgaagcctggtttcgagggcaaggtcttctatgtctggttcgacgcgccgatcgcc
tatatcgccgcgacccaggactggtcggacgccgatcccgaccatcgtgattggcgcgcc
tggtggtggcaggcggacgatgtcgaatatgcccagttcctgggcaaggacaacgtgccg
ttccacgcggtcagttttccctgcaccctgatcggttcgggcgagccgtggaagaccgtc
gacgtcatcaaaggcgtgaactggctgacctatgagggcggcaaattctcgaccagccag
cgccgcgggttgttcctggatcaggcgctcgacctgctgccggccgattactggcgctgg
tggctggcggccaatgcgcccgagagccgggacaccgatttcagcttcgagcgcttcgcg
accgatgtgaacaacgatctcgccgacactttcggcaatctggtcaaccgcgtcctgacg
ttcaccgtcaaccgtcacggcgggatcgtgcccggcggcggggtttccgctgaacccgag
gcgcgtcttgccgccgcacttcagcggcagctggatgacctgcgcggccatcacaagggc
tgcgcactccgcaaggccgccggaacggttcgggcgatctggcgccttgccaacggctat
ctcgccgatgaagcaccctggaggagttttgccaatgcccccgagcgggcggccgtggtg
gtcagaaccggggtcaacctggtggccgccgcggcgacggtggcctggcccttcattccc
gaggccgcggacaaggtcctgagggccttggggcgttctgccggcgtgccgcccttgccg
caatccgccgccagcgccttgcgcgaggtcccttccggccaggaggtgagcctgccaccg
gtgctgttcgccaagctgacgccggaatgggtggcggcaagccgggcgcggtttgctggc
ggcggcagctga

DBGET integrated database retrieval system