KEGG   Plautia stali symbiont: E05_05090Help
Entry
E05_05090         CDS       T03051                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
psts  Plautia stali symbiont
Pathway
psts00970  Aminoacyl-tRNA biosynthesis
psts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psts00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E05_05090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psts03029]
    E05_05090
Enzymes [BR:psts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     E05_05090
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     E05_05090
Mitochondrial biogenesis [BR:psts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    E05_05090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAN95275
UniProt: U3TNG3
Position
441306..441992
Genome map
AA seq 228 aa AA seqDB search
MRSCWLLDSVIADQPLQLAELDIARAHFAIPQTRVLDGLDLAVSQAWHHALAQLRAQGAT
LTELPLPELAELETINARGGITAWEAWQWHQSLLQSHAAGYDPQVRMRIERGALLNEADA
QLLYQQRADWRQRVEQAVAPFDGLLLSTVPLIAPTIAELDDPERYCQVNLLMLRNTSVIN
MLDGCAISLPCHQSGSAPVGLMLAATHGHDAALLSWALALESILQRSL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagctgctggctgctcgacagcgtcatcgccgatcagcctttgcagctggcagag
cttgatatcgcgcgggcgcactttgctattccacagacccgggtgctggacgggctggat
ctcgcggtcagccaggcctggcaccacgcgctggcacagctgcgcgcgcagggtgccacg
ctcaccgagctgccgctgcctgaactggcggaactggaaaccattaacgcccgtggcggc
atcaccgcctgggaagcctggcagtggcatcagtcgctgctgcagtcgcacgcggcgggt
tatgacccgcaggtgcggatgcgcattgagcgcggcgcgttgctgaatgaggccgacgca
caactgttgtatcagcagcgcgccgactggcggcagcgggtggagcaggcggtggcacct
ttcgatggcttgctgctatccaccgtgccgctgattgcgccgaccatcgccgaactcgac
gacccggagcgctattgccaggtcaacctgctgatgctgcgcaacaccagcgtgatcaac
atgctggacggctgcgccatctccctgccttgtcatcagtccggcagtgcgccggtgggt
ctgatgctggccgccacacatggccacgatgccgcgctgctcagctgggcgctggcgctt
gaatccatcctgcaacggagtctctga

DBGET integrated database retrieval system