KEGG   Plautia stali symbiont: E05_11300Help
Entry
E05_11300         CDS       T03051                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
psts  Plautia stali symbiont
Pathway
psts00010  Glycolysis / Gluconeogenesis
psts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E05_11300
Enzymes [BR:psts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     E05_11300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: BAN95896
UniProt: U3TV74
Position
918251..918862
Genome map
AA seq 203 aa AA seqDB search
MIKKLSLCALSVIAALPMGMSAYAADGDMQLQQVLMLSRHNLRAPLANNGSVLEQATKKS
WPQWDVPGGELTTKGGVLEVYMGNYTRQWLAQQGLVQNGTSPDSSNTFVYANSLQRTVAT
AQYFVTGAFPGCDIAVTYQDAMGTMDPIFNPVITYGSEAFNKKALAAMTAANEKLALKTA
FQRLEKSWITNQPRPVVARNSAI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaactgagtctttgcgcgctgtcagtgatcgcggcgctgccgatgggtatg
agcgcttacgccgcggatggcgacatgcaactgcagcaggtcctgatgctgagtcgtcac
aacctgcgtgccccgctggccaacaacggcagcgtgctggagcaggcgacgaaaaaaagc
tggccgcagtgggatgtgcccggcggtgaactgaccaccaaaggcggcgtgctggaagtc
tacatgggtaactacacccgtcagtggctggcccagcaggggctggtacagaacggcacc
agtccggacagcagcaacacctttgtctatgccaacagcctgcagcgcaccgtcgcgacg
gcgcagtatttcgtcaccggtgctttcccgggctgcgatatcgctgtcacctatcaggat
gcgatgggcaccatggatccgatcttcaatccggtgatcacctatggcagcgaagcgttt
aacaagaaagcgctggcggcgatgaccgcagccaatgagaagctggcgttgaagacggcc
ttccagcggctggaaaaatcgtggattacaaatcagccccggcctgtagtggcaagaaac
agtgcgatctga

DBGET integrated database retrieval system