KEGG   Plautia stali symbiont: E05_40020Help
Entry
E05_40020         CDS       T03051                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
psts  Plautia stali symbiont
Pathway
psts00020  Citrate cycle (TCA cycle)
psts00620  Pyruvate metabolism
psts01100  Metabolic pathways
psts01110  Biosynthesis of secondary metabolites
psts01120  Microbial metabolism in diverse environments
psts01130  Biosynthesis of antibiotics
psts01200  Carbon metabolism
Module
psts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E05_40020
   00620 Pyruvate metabolism
    E05_40020
Enzymes [BR:psts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     E05_40020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo K_oxygenase HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAN98768
UniProt: U3U3R2
Position
3168918..3169253
Genome map
AA seq 111 aa AA seqDB search
MGTDVNFGEVTRQLIAALEKKENFRLRLRQEVRDIKRLSDGRWQVSLHNLASGEPRVLTA
RQLFIGAGGAALPLLQKTGIPEVKGYAGFPVGGSFLVTENPDVVAQHMAKV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgacgttaacttcggtgaggtaacgcgccagctgattgccgcgctggagaag
aaagagaatttccgcctgcgtctgcgtcaggaagtgcgcgatatcaagcgcctgagcgat
ggtcgctggcaggtaagcctgcacaacctcgccagcggtgagccgcgggtgctgactgcg
cgccagctgtttatcggtgccggcggtgcggcgctgccgctgctgcaaaaaaccggcatc
ccggaagtaaaaggctacgccggtttcccggtgggcggctcgttcctcgtcacggaaaat
ccggacgtggtggcgcagcacatggcgaaggtgtag

DBGET integrated database retrieval system