KEGG   Plautia stali symbiont: E05_41470Help
Entry
E05_41470         CDS       T03051                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
psts  Plautia stali symbiont
Pathway
psts00010  Glycolysis / Gluconeogenesis
psts00020  Citrate cycle (TCA cycle)
psts00620  Pyruvate metabolism
psts01100  Metabolic pathways
psts01110  Biosynthesis of secondary metabolites
psts01120  Microbial metabolism in diverse environments
psts01130  Biosynthesis of antibiotics
psts01200  Carbon metabolism
Module
psts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E05_41470
   00020 Citrate cycle (TCA cycle)
    E05_41470
   00620 Pyruvate metabolism
    E05_41470
Enzymes [BR:psts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     E05_41470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: BAN98913
UniProt: U3U454
Position
3277799..3278137
Genome map
AA seq 112 aa AA seqDB search
MQASGAQAYLVNTGWNSSGKRISLKDTRAIINAILAGELDEAETVTLPVFNLQVPTTLAQ
VDDAILDPCRSWPDDAAWQQAAEALAQRFITNFEKYTDNDAGKALVQAGPQL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgtccggcgcgcaggcctatctggtgaataccggctggaacagcagcggcaag
cgcatttcgctgaaagacacgcgcgctatcatcaacgcgattctggccggtgagctggat
gaagccgagaccgtgacgctgccagtattcaatctgcaggtgcctaccacgctggcacag
gtggacgatgccattctcgatccgtgccgcagctggcctgacgacgccgcctggcagcag
gctgccgaagcgctggcgcagcgctttatcaccaatttcgagaagtacaccgataacgat
gccggcaaggcgctggtgcaggccggcccgcagctgtga

DBGET integrated database retrieval system