KEGG   Plautia stali symbiont: E05_46280Help
Entry
E05_46280         CDS       T03051                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
psts  Plautia stali symbiont
Brite
KEGG Orthology (KO) [BR:psts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psts03016]
    E05_46280
Enzymes [BR:psts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     E05_46280
Transfer RNA biogenesis [BR:psts03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    E05_46280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: BAN99394
UniProt: U3U3J0
Position
complement(3645497..3646276)
Genome map
AA seq 259 aa AA seqDB search
MLEIIYQDAWLVAVNKPAGWLVHRSWLDRKEKVVVMQTVRDQIGQHVFTAHCLDRPTSGV
LLMGLSSEIGRLLAQQFEQHQIQKTYHAVVRGWLDGSATLDYPLVEELDKIADKFVTEPR
APQPAVTDYRALAQAELPVAIGKYSSARYTLVELSPHTGRKHQLRRHMAHLRHPIIGDSS
HGDLRQNRGAAAHFGMDRLMLHASALTLTHPVTGEPLVIRAGLDRVWQQMLHPFGWQQQL
PDVPRVEFAAEAVQDKPTE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcatttatcaggatgcatggctggttgcggtgaataaaccggcgggctgg
ctggtgcaccgcagctggctcgatcgcaaagagaaagtggtggtgatgcagacggtgcgc
gatcagattggtcagcacgtatttaccgcgcattgcctcgatcgtcccacttctggcgtg
ctgctgatgggactctccagcgaaatcgggcggctgctggcgcagcagtttgagcagcat
cagattcagaaaacctatcacgcagtggtgcgcggctggctggacggtagcgcaacgctg
gattatccgctggtggaagagctggataaaattgcggacaagtttgtcacggaaccgcga
gcgccgcagccggcggtcaccgattatcgcgcgctggcgcaggcggaactgccagtggct
atcggcaagtactccagcgcacgttatacgctggttgagctgtcgccgcacaccgggcgc
aagcatcaactgcggcgccatatggcgcacctgcgtcatcctattattggtgacagctcg
cacggcgatctgcggcagaaccgcggtgccgcggcccactttggcatggatcgactgatg
ctgcacgccagtgcgctgacgctaacgcatccggtgaccggcgaaccgctggtgattcgc
gccgggctggatcgcgtctggcagcagatgctgcacccgtttggctggcagcagcaactg
cctgatgtgccgagggttgagtttgccgctgaggcagtccaggataagccgacagaataa

DBGET integrated database retrieval system