KEGG   Pseudomonas stutzeri 28a24: CH92_00985Help
Entry
CH92_00985        CDS       T03390                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00030  Pentose phosphate pathway
pstt00480  Glutathione metabolism
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01120  Microbial metabolism in diverse environments
pstt01130  Biosynthesis of antibiotics
pstt01200  Carbon metabolism
Module
pstt_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CH92_00985
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH92_00985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pstt04147]
    CH92_00985
Enzymes [BR:pstt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CH92_00985
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CH92_00985
Exosome [BR:pstt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CH92_00985
  Exosomal proteins of colorectal cancer cells
   CH92_00985
  Exosomal proteins of bladder cancer cells
   CH92_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHL73741
UniProt: W8RP01
Position
complement(213252..214694)
Genome map
AA seq 480 aa AA seqDB search
MSISCDMLVFGGTGDLALHKLIPALYHLHREHRLHDDVRILAISRQEIDRNAYLSLAERH
CRAEIARTDFEADTWEAFSQRLDYFAMDALQRGEFVGLAHYLGQAEGRVRVHYLATAPRL
FEPIASNLESAGLAGEDARIVLEKPIGHSLDSALEINEAIGAVFPESRIYRIDHYLGKET
VQNLMALRFANALFEPIWRSGHIDHVQITVAETLGVENRGSYYDHAGAMRDMLQNHLLQL
LCLVAMEAPVRFDAKSIRGEKVKILEALKPITGNDVQDKTVRGQYGAGRIGGHDVQAYYF
ENDVDNDSDTETFVAVKAEIDNWRWAGVPFYLRTGKRMSRKRSEIIITFKQVPHMLFTKG
EVNRLVISLQPEESISLQLMAKAPGKGMQLEPVELDLNLANAFSKTRRWEAYERLLLDVI
EGDSTLFMRRDEVEAAWNWVDPILRGWQSHYRKPRPYPAGTDGPEQAHQLIEHQGRRWWR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgtccatttcctgcgacatgctggtatttggcggtaccggtgatctggcgctacacaaa
ctcatccctgcgctttatcacctgcaccgcgaacaccgtctgcacgacgacgtacgcatc
ctcgcgatctcccgtcaggagatcgaccgcaacgcctatctaagcctggccgagcgccat
tgccgtgcggaaatcgcacgcaccgacttcgaggctgacacctgggaagcgttcagtcag
cgtctcgattacttcgccatggacgccttgcagcgaggcgaattcgtcggcctcgcgcac
tacctcggccaagccgaggggcgcgtgcgggtgcactatctggcaaccgcgccacgcctg
ttcgaacccattgcctccaatctggaaagcgcaggccttgccggggaagacgcccgcatc
gtgctggaaaagcccatcggccattcgctggattcggcgctggaaatcaacgaagcaatc
ggcgcagtgttccccgaatcgcggatctaccggatcgatcactatttgggcaaggaaacc
gtgcagaacctcatggcgctgcgcttcgccaacgcgctgttcgagccgatctggcgcagc
ggccacatcgaccatgtgcaaatcaccgtggccgaaaccctcggcgtcgagaatcgcggt
agctactacgaccacgccggcgccatgcgcgacatgctgcagaaccatctgctgcaactg
ctctgcctggtggcgatggaggcgccggtgcgattcgatgccaagtcgatacgcggcgag
aaggtgaagatcctcgaagccctcaagccgatcaccggtaatgacgtgcaggacaagacc
gtgcgcggccaatatggcgccggccgcatcggtggccacgatgtgcaggcctactacttc
gaaaacgatgtcgacaacgacagcgacaccgagaccttcgtcgcggtgaaggccgagatc
gacaactggcgctgggccggcgtgcccttctacctgcgcaccggcaagcgcatgtcgcgc
aagcgttcggagatcatcatcaccttcaagcaggtgccgcacatgctcttcaccaagggc
gaggtcaaccgcctggtgatcagcctgcaacccgaagaaagtatcagcctgcaactgatg
gccaaggcaccgggcaagggcatgcaactggagcccgtcgagctggacctcaatcttgcc
aatgccttcagcaagacgcgccgctgggaggcttacgagcggctgctgctggatgtcatc
gaaggcgattcgacgctgttcatgcgccgcgacgaggtggaagccgcctggaactgggtc
gatccgatcctgcgcggctggcaaagccattaccgcaaaccgagaccctacccggccggg
accgatggtcctgaacaggcgcaccagctgatcgaacaccagggccgccgatggtggcgc
tga

DBGET integrated database retrieval system