KEGG   Pseudomonas stutzeri 28a24: CH92_03730Help
Entry
CH92_03730        CDS       T03390                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00625  Chloroalkane and chloroalkene degradation
pstt00680  Methane metabolism
pstt01100  Metabolic pathways
pstt01120  Microbial metabolism in diverse environments
pstt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CH92_03730
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CH92_03730
Enzymes [BR:pstt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     CH92_03730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N AlaDh_PNT_C ADH_zinc_N AdoHcyase_NAD FAD_binding_2 2-Hacid_dh_C FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHL74242
UniProt: W8R7D4
Position
complement(771706..772905)
Genome map
AA seq 399 aa AA seqDB search
MADNRGVVYLGAGKVEVQSIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGNDVENLQLGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARP
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPNRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPVRLQHAKAQGFEIADLSQD
TPLHEQIANLLGEPEVDCAVDAVGFEARGHGHAGVQHEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRINIA
EVVGVQVISLDEAPKGYGEFDAGVPKKFVIDPHKMFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatcgtggcgttgtttacctaggcgcaggcaaggtcgaagtgcagagcatc
gactaccccaagatgcaggatccacgcgggcgcaagatcgagcacggcgtgatcctgcgc
gtcgtttccaccaacatctgcggctcggaccagcacatggttcgcggccgcaccaccgcg
cagacaggcctggtactgggccatgaaatcaccggtgaagtgatcgagaaaggcaacgat
gtcgagaacctgcagcttggcgacctggtctcggtgcccttcaacgtggcctgcggtcgc
tgccgttcgtgcaaggaaatgcataccggcgtctgcctgaccgtcaacccggcccgcccg
ggcggtgcctacggctatgtcgacatgggtgactggaccggcggccaggccgaatacgtg
ctggtcccctacgctgacttcaacctgctcaagctgcccaaccgcgacaaggcgatggag
aagatccgcgacctgacctgcctgtccgacatcctgcccaccggctatcacggcgcggtg
actgccggtgtcggcccgggcagcacggtctatatcgctggtgccggcccggtcgggctt
gccgccgctgcgtccgcgcgcttgctcggtgctgcggtggtcatcgtcggcgacgtcaat
ccggtgcgtttgcagcacgcgaaagcacagggtttcgagattgccgacctgtcccaggac
acgccgctgcatgagcaaatcgccaatctgttgggcgagccggaagtggactgcgcggtg
gatgcggtgggcttcgaagcccgcggtcacggccatgccggggtacagcacgaagcgcca
gcaacggtgcttaactcactgatgggcgtggtgcgcgtcgccggcaagatcggtattccc
ggcctctacgttaccgaggatcccggcgcagtggacgctgcggcgaagatgggcagcctg
agcatccgctttggcctgggctgggccaagtcgcacagtttccataccggccagaccccg
gtaatgaagtacaaccgcgccctgatgcaagcgatcatgtgggaccgcatcaacatcgcc
gaagtggtcggcgtgcaggtgatcagcctggacgaagcgccaaagggctacggcgagttc
gatgccggcgtgccgaagaaattcgtcatcgacccgcacaagatgttcagcgccgcctga

DBGET integrated database retrieval system