KEGG   Pseudomonas stutzeri 28a24: CH92_07810Help
Entry
CH92_07810        CDS       T03390                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00260  Glycine, serine and threonine metabolism
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01120  Microbial metabolism in diverse environments
pstt01130  Biosynthesis of antibiotics
pstt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CH92_07810
Enzymes [BR:pstt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CH92_07810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHL75012
UniProt: W8R9H5
Position
1635138..1636142
Genome map
AA seq 334 aa AA seqDB search
MSLIDLRSDTVTQPTAGMRDAMLSAPTGDDVYGEDPTVRRLEQTLAAQLGLDAGLFVPSG
TMSNLLALMSHCQRGDEYIAGQLAHTYKYEAGGAAVLGSIQPQPIEVEADGSLDLDRVAA
AIKPDDFHFARTRLLALENTMQGKVLPLEYLAEARAFTHDRGLALHLDGARLFNAVVRLG
CSARDISRHFDSVSVCLSKGLGAPVGSVLCGDVSFIAKARRLRKMVGGGMRQAGVLAAAG
LYALEHQVQRLAEDHQRARAIAEGLQALGYAVEPVQTNMVYVQMGDRAGALKAFCAERGV
RLTAAPRLRMVTHLDVQPEHVDPILESFAAFVDA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttattgatcttcgcagcgatacggttacccagcctacggctggcatgcgtgac
gccatgctaagcgcccccaccggagacgacgtttacggcgaggatccaacggttcgtcgg
ctggagcagacgctggcggcgcaattgggtttggacgccggactgttcgtgcccagcggc
accatgagcaatctgctggcgctcatgtcgcattgccaacgtggtgatgagtacatcgcc
ggtcaactggcgcatacctataaatacgaggccggaggcgctgcggtgctcggctcgatt
caaccacagccgatcgaggtggaagcggacggttctttggaccttgatcgtgtcgcagca
gcgatcaaaccggacgactttcatttcgcccgtacccgcttgctggcgctggaaaacacc
atgcagggcaaggttctgccactcgaatatctggccgaggcgcgtgcgttcacacacgat
cgggggcttgccctgcatctcgacggtgctcgattgttcaatgcagtagtcaggctgggt
tgctcagcgcgggacatcagtcgccacttcgactccgtttcggtgtgcctgtccaagggg
ttgggcgcgccggtcggctcggtgctttgcggcgatgtatctttcattgccaaggctcgt
cgcttgcgcaagatggtcggcggcggcatgcgtcaggccggtgtgctggcggctgcagga
ctctatgcgctggagcaccaggtacagcgtctggcagaggatcaccagcgcgcgcgggct
attgcggaggggctgcaagccctgggttatgccgtcgagccggtgcagacgaacatggtc
tacgtacagatgggtgatcgcgctggggcgctgaaggcattctgcgccgagcgtggcgta
cgcttgaccgcggcgccgcggctgcggatggtgacgcatctggatgtgcagcccgagcat
gtcgatccgatcctcgagagcttcgccgcattcgtcgacgcatag

DBGET integrated database retrieval system