KEGG   Pseudomonas stutzeri 28a24: CH92_08660Help
Entry
CH92_08660        CDS       T03390                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pstt  Pseudomonas stutzeri 28a24
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pstt03009]
    CH92_08660
Enzymes [BR:pstt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     CH92_08660
Ribosome biogenesis [BR:pstt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CH92_08660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AHL75177
UniProt: W8R9W9
Position
1815290..1816339
Genome map
AA seq 349 aa AA seqDB search
MNTLLLHCRPGFENEVCAEISDQAARLSVAGYAKAKPNSACAEFICSEPEQAQRLMHGVR
FARLIFARQWARGEHLTLPETDRIGVLLEQLKAYPVCGSVWLEVLDTNDGKELSNFCRKF
EAPLRKALTKAGRLVEGGSGPRLLLTFKSGREVFLGIAEADNSAMWPMGIPRLKFPRQAP
SRSTLKLEEAWHHFIPREQWDARLAPGMTAVDLGASPGGWTWQLVNRDIEVMAVDNGPMN
QELLESGLVGHYRADGFAFRPKQPVDWMVCDIVEKPAKNAALLETWIGEGLCREAVVNLK
LPMKQRYAEVKRLLERIADGLAERGVKASIGCKQLYHDREEVTCHLRRR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattgctgctgcactgccgcccaggcttcgaaaatgaagtctgcgccgagatc
agcgaccaggccgcccgactgagcgtggccggctacgccaaggcgaaaccgaacagcgcc
tgcgccgagttcatttgcagcgagccggaacaagcgcagcgattgatgcacggcgtgcgc
ttcgcccgcttgatcttcgctcggcaatgggcgcgcggcgagcatctgacgctgccagag
accgaccgtatcggcgtattgctcgaacaactcaaggcctacccggtatgcggcagcgtc
tggctcgaggtgctggacaccaacgatggcaaggaactgtcgaacttctgccgcaagttc
gaggccccgttacgcaaggcgctgaccaaggctggacggctggtcgaaggtggctcgggg
ccgcgcttgctgctgaccttcaaaagtggccgcgaggtatttctcggcatcgctgaggcc
gacaacagcgccatgtggccgatgggtattcctcgcctgaagttcccaaggcaggcgccg
agccgctcaacgctgaagctggaagaggcctggcatcacttcattccgcgcgagcagtgg
gacgcgcgattggcacccggtatgaccgcggtggatctgggcgcatcgccaggcggctgg
acctggcagctggtcaaccgggacatagaagtgatggctgtggataacgggccgatgaac
caggagttgctggaatccggcctggttgggcattaccgcgccgacgggttcgccttccgc
ccgaagcagccggtggactggatggtctgcgatatcgtcgagaagccggcaaagaacgct
gccttgctggaaacctggatcggcgaaggtctgtgccgagaggcggtggtcaacctcaag
ttgccgatgaaacaacgctacgcggaggtgaagcggctgctggaacgcatcgccgatggg
cttgccgaacgaggggtgaaagcgagcattggctgcaagcagctttaccatgaccgcgag
gaagtgacctgccatttgcgtcgccggtga

DBGET integrated database retrieval system