KEGG   Pseudomonas stutzeri 28a24: CH92_08915Help
Entry
CH92_08915        CDS       T03390                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00450  Selenocompound metabolism
pstt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CH92_08915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pstt03016]
    CH92_08915
Enzymes [BR:pstt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CH92_08915
Transfer RNA biogenesis [BR:pstt03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    CH92_08915
 Prokaryotic type
    CH92_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AHL75228
UniProt: W8R6N2
Position
1872742..1873776
Genome map
AA seq 344 aa AA seqDB search
MSEPIRLTQYSHGAGCGCKISPKVLDVILAGSGAQNLDPRLWVGNASRDDAAVYGIDEER
GVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNLLPPEVAREV
IAGGRAVCDAAGIPLAGGHSIDAPEPIFGLAVTGLVNKTQMKRNDTASVGCKLYLTKPLG
IGILTTAEKKAKLRPEDVGRARDWMCTLNTPGSRFGKLAGVRAMTDVTGFGLLGHLVEMA
DGSGVTARIDYARVPRLEGVEYYLDQGCVPGGTGRNFDSYGERIAALDEVHKQLLCDPQT
SGGLLVAVAPEGEAEFLAVATELGLALEPIGELVEAGAFAVEVR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacccatccgcctcactcaatacagccacggtgccggctgcggttgcaagatt
tcgcccaaggtgctggacgtgatcctcgccggcagtggcgcgcagaatctcgatccgcgg
ctgtgggtcggcaacgcctcgcgtgatgatgccgccgtctacggtatcgacgaagagcgc
ggcgtggtctcgaccaccgatttcttcatgcccatcgtcgatgatcctttcgacttcgga
cgcatcgccgccaccaatgccatcagcgatatctacgccatgggcggcgatccgctgatg
gctattgcgattctcggctggccggtcaatctgctgccgccggaagtggctcgtgaagtg
attgccggcgggcgcgctgtctgtgatgcggcgggcattccgctggctggggggcactcg
atcgatgcccctgaacctatcttcggcctggctgtgaccggcctggtaaataaaacgcag
atgaaacgaaacgacacggcctcggtgggctgcaagctctacctgaccaagccgctgggc
atcgggattctcaccactgcagagaaaaaggccaagctgcggcccgaagatgtcggccga
gcgcgtgactggatgtgcacgctgaacacgcccggcagccgtttcggcaagcttgctggc
gtccgcgccatgaccgatgtcaccggcttcggcctgctcgggcatctggtggaaatggcg
gatggtagcggtgtgacagcgcgcatcgactacgcccgggtcccgcgcctcgagggcgtc
gagtattacctggatcagggctgcgtgcccggcggcaccgggcgcaacttcgacagctat
ggcgaacgtatcgccgcgctggatgaggtgcacaaacaattgctgtgcgacccgcaaacc
agtggcgggttgctggtggcggtggcacccgaaggtgaggcggaatttctcgcggtggcg
actgagctcggtctggcgcttgagccgatcggcgagctggtcgaagccggtgcctttgct
gtcgaggttcgttga

DBGET integrated database retrieval system