KEGG   Pseudomonas stutzeri 28a24: CH92_10730Help
Entry
CH92_10730        CDS       T03390                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00071  Fatty acid degradation
pstt00072  Synthesis and degradation of ketone bodies
pstt00280  Valine, leucine and isoleucine degradation
pstt00310  Lysine degradation
pstt00362  Benzoate degradation
pstt00380  Tryptophan metabolism
pstt00620  Pyruvate metabolism
pstt00630  Glyoxylate and dicarboxylate metabolism
pstt00640  Propanoate metabolism
pstt00650  Butanoate metabolism
pstt00900  Terpenoid backbone biosynthesis
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01120  Microbial metabolism in diverse environments
pstt01130  Biosynthesis of antibiotics
pstt01200  Carbon metabolism
pstt01212  Fatty acid metabolism
pstt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH92_10730
   00630 Glyoxylate and dicarboxylate metabolism
    CH92_10730
   00640 Propanoate metabolism
    CH92_10730
   00650 Butanoate metabolism
    CH92_10730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH92_10730
   00072 Synthesis and degradation of ketone bodies
    CH92_10730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH92_10730
   00310 Lysine degradation
    CH92_10730
   00380 Tryptophan metabolism
    CH92_10730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CH92_10730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH92_10730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH92_10730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pstt04147]
    CH92_10730
Enzymes [BR:pstt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CH92_10730
Exosome [BR:pstt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CH92_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHL75553
UniProt: W8R7L1
Position
2263334..2264521
Genome map
AA seq 395 aa AA seqDB search
MNNDPIVILGSARTPMGGFQGDLKSLSAPELGAAAIRAAVERSGVSAEQVQEVLMGCVLP
AGLGQAPARQAALGAGLGKATATTTLNKMCGSGMQAAILAHDALRAGSVDLIVAGGMESM
SNAPYLLEKARGGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAQNHGFSREEQDA
YALTSLQRARDAITAGRFAREIVPLDVTQGREQRTIRDDEQPPKSMPEKIPSLKPAFRDG
GTVTAANSSSISDGAAALVLTRRSEAERRGLKPQALIHGHAVFADAPNLFPTAPIGAIHK
LLERTGWRLDEVDLFEINEAFAVVSMVTMRELGLDHAKVNVNGGACALGHPIGASGARIL
VTLIAALRDRGLRKGIAAICIGGGEATAMAVELLD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgatccaatcgtgattctcggcagcgcccgcacccccatgggtggctttcaa
ggcgatctgaaaagcctcagcgcgccggagctgggcgcggcggcgattcgcgctgcagtg
gagcgcagcggtgtctcagccgaacaggtgcaggaagtgttgatgggctgcgtgcttcca
gccggcctcggccaggcgccggcacggcaggcggcgctcggcgcggggctgggcaaagcc
accgcgaccactacgctgaacaagatgtgcggctcgggcatgcaggcggcgattctcgcc
cacgacgcgttgcgtgccggcagcgtcgacctgatcgtcgcgggtggcatggaaagcatg
tccaacgcgccttatctgctggaaaaggctcgcggcggttatcgcatgggtcacggcaag
gtgctcgatcacatgttcctcgacggcctcgaagatgcctacgacaagggccggttgatg
ggcacctttgccgaggactgcgcgcagaaccacggcttcagccgcgaagagcaggacgcc
tacgcactgacgtcgctgcagcgtgctcgggacgccattaccgcgggccgtttcgccagg
gagatcgtcccgctggatgtcacccaagggcgcgagcagcgcaccattcgcgacgatgaa
cagccgcccaagtcgatgccggagaagattccgtccctcaagccggcgttccgcgacggc
ggcactgttaccgcagccaactccagctcgatatccgatggcgccgcggcgctggtgctg
acgcggcgttccgaggccgagcgtcgcggcttgaagcctcaggcgctcatccatggccac
gcggtgtttgccgacgcaccgaacctgttcccgactgcgcctatcggcgccattcacaag
ctgttggagcgcaccggctggcgtctcgacgaggtggatctgttcgagatcaacgaggcc
ttcgccgtagtcagcatggtcaccatgcgcgagctcggtctggatcacgccaaggtcaac
gtcaacggtggtgcctgcgccctcggccacccgatcggtgcgtctggtgcgcgcattctc
gtgacgctgattgccgcgctgcgcgaccgtgggctgcgcaagggcattgcggccatctgc
atcggcggtggcgaagcgaccgccatggccgtcgaactgctcgattga

DBGET integrated database retrieval system