KEGG   Pseudomonas stutzeri 28a24: CH92_11615Help
Entry
CH92_11615        CDS       T03390                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00130  Ubiquinone and other terpenoid-quinone biosynthesis
pstt00627  Aminobenzoate degradation
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01120  Microbial metabolism in diverse environments
pstt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CH92_11615
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CH92_11615
Enzymes [BR:pstt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CH92_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Phage_holin_2_2
Motif
Other DBs
NCBI-ProteinID: AHL75717
UniProt: W8RB94
Position
2475255..2475893
Genome map
AA seq 212 aa AA seqDB search
MTSANPRPQRLIIGISGASGAIYGVRLLELLRDTPIETHLMVTKSALITLAHETGLSWTQ
LKAMATVAYSNQDIGAAIASGSFKTMGMIVAPCSVRTMSEIASGVTSSLLTRAADVILKE
QRRLVLMVRETPLHRNHLRTMTELAELGAVIAPPVPAFYARPASIDDMVNHTLGRVLDMF
DIELGIVRRWRDEPEVVPTLDEIEAADAAENA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagctaacccgcgcccccaacggctcattatcggcatatccggggcctccggc
gcgatatacggcgtgcgtctgctcgaactgctgcgcgacacgccaattgaaacgcacctg
atggttaccaagtcagcgctgatcacccttgcccatgaaaccggactttcctggacgcag
ctcaaggccatggccacggtcgcttattccaaccaggacatcggggccgccatcgccagc
ggttcgttcaagacgatgggcatgatcgtcgcgccgtgttcggtgcgcacgatgtctgaa
atcgccagcggcgtaacttcatcgctactcacccgcgccgcggacgtgatcctgaaggaa
caacgtcgattggtactgatggtgcgcgaaacgccgttgcaccgtaatcacttgcgcacc
atgaccgaattggctgagctgggtgccgtcattgcgccgccggttccggcgttctatgcg
cgccccgcttcgatcgacgacatggtcaatcacacgctcggacgtgtcctggatatgttc
gatatcgaattgggcatcgtgcggcgctggcgtgacgagcccgaagtcgtcccgacgctc
gacgagattgaggcagctgatgccgccgagaatgcgtga

DBGET integrated database retrieval system