KEGG   Pseudomonas stutzeri 28a24: CH92_11775Help
Entry
CH92_11775        CDS       T03390                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CH92_11775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pstt01007]
    CH92_11775
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pstt03016]
    CH92_11775
Enzymes [BR:pstt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     CH92_11775
Amino acid related enzymes [BR:pstt01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CH92_11775
Transfer RNA biogenesis [BR:pstt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CH92_11775
 Prokaryotic type
    CH92_11775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AHL75740
UniProt: W8QYL7
Position
complement(2517798..2519183)
Genome map
AA seq 461 aa AA seqDB search
MALSIYNTLTKAKEPLKPLIDNQVRMYVCGMTVYDFCHIGHARVMVAFDVVSRWLRQRGY
DLTYVRNITDIDDKIIRRAQENGESFDALTGRMIAAMHEDEARLSVLRPDLEPRATEHIA
GMHSMIQTLIDKGFAYAPGNGDVYYRVGKFVGYGKLSRRKIEDLKIGARIEVDEAKQDPL
DFVLWKAAKPGEPSWDSPWGAGRPGWHIECSVMSTCCLGETFDIHGGGPDLVFPHHENEI
AQSEAATGKLYANAWMHAGAVRVDGEKMSKSLGNFFTIREVLEKYQPEVVRYLLVSSHYR
SPINYSEDSLKEAKGALERFYHALKGLPDAAPIGGEAFIERFSAAMDDDFNTPEACAVLF
ELAREVNRLRVSDPQAAAGLAARLKALAEPLGVLHLEPDDFLQAGAAGKVDAAEVEALIA
ARLQARVEKNWAESDRIRDQLTAMNVVLEDGKGGTTWRLAD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtcgatctacaacaccctgaccaaggccaaggagcccctcaagccgctgatt
gataaccaggtgcgcatgtacgtatgtggcatgacggtctatgacttctgccacatcggc
catgcgcgggtcatggtggcgttcgacgtggtctcgcgttggctgcgccagcgcggctat
gacctgacctacgtgcgcaacattaccgatatcgacgacaagatcatccgccgcgcccag
gaaaacggtgaaagcttcgacgcgctcaccgggcgtatgatcgctgcgatgcatgaggac
gaggctaggctcagcgtcttgcgtccggatctcgagccgcgtgcgaccgagcacatcgcc
ggcatgcacagcatgatccagaccttgatcgacaagggcttcgcctacgcgccgggtaat
ggcgatgtctattaccgagtcggcaagttcgtcggctacggcaaactgtcacggcgcaag
atcgaagacctgaagatcggagctcgcatcgaagttgacgaagccaagcaagacccgctg
gatttcgtgctttggaaggcggccaagccgggcgaaccgagctgggattcgccgtgggga
gcggggcgtccgggttggcatatcgaatgctcggtcatgtccacctgctgcctgggtgag
accttcgacatccatggtgggggccccgatctcgtgtttccgcaccacgaaaacgaaatc
gcacagagcgaagcggcgaccggcaagctgtacgccaacgcctggatgcacgctggagcg
gtccgtgtcgatggggagaagatgtccaagtcgctgggcaatttcttcaccatccgcgag
gtgctggaaaagtatcagccggaagtggttcgctatctgttggtttccagccactaccgc
agcccgatcaactattccgaagacagcctgaaagaagccaaaggcgcgcttgagcgcttc
taccatgccttaaagggcctgcctgacgcggcgcccataggcggtgaggctttcattgaa
cgtttctcggcggcgatggacgacgacttcaataccccggaagcctgcgctgtgctcttt
gaattggctcgcgaggtcaaccgtctgcgcgtgtccgatccgcaggccgctgctggcttg
gcggcgcgcctaaaggcgctggccgaaccgcttggtgtgctgcatctggagccggacgac
ttcctgcaagccggtgccgcaggcaaggtagacgcagctgaggtggaggcgctgatcgcc
gctcgcctgcaggctcgcgtcgagaaaaactgggcagagtccgaccgcatccgcgatcag
ctcaccgcgatgaacgtggtcttggaagacggcaagggcgggacgacctggcggctggct
gactga

DBGET integrated database retrieval system