KEGG   Pseudomonas stutzeri 28a24: CH92_19420Help
Entry
CH92_19420        CDS       T03390                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00030  Pentose phosphate pathway
pstt01100  Metabolic pathways
pstt01120  Microbial metabolism in diverse environments
pstt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pstt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CH92_19420
Enzymes [BR:pstt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CH92_19420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Glyco_tran_WecB Epimerase
Motif
Other DBs
NCBI-ProteinID: AHL77125
UniProt: W8R2L7
Position
complement(4178891..4179658)
Genome map
AA seq 255 aa AA seqDB search
MKLQNKVALVTGSSQGIGRGIAVRLAEEGADLVINGRHDDDESRETLEQVRALGRHACFI
ATDVGVVAECQRLVAQAIEQMGRLDILVNNAGVQRHSPFLDAGEGDYDLVLNVNLRGPFF
LAQAFARHLRDTGRGGRIINNSSVHEELPFPNFTGYCLSKGGLKMLMRNLAIELAPLGIT
VNNVAPGAIETPINRALMNQPEKLAGLLNNIPAGRLGQPRDVAGAVAFLASDEADYITGT
TLVVDGGLLWSYTEQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcagaacaaggtcgcgctggtcaccggaagctcccagggcatcggccgtggc
atcgccgtgcgcctggccgaggagggggccgatctggtcatcaatggccggcacgatgac
gacgaatcccgggaaactctcgagcaggttcgcgcgctgggtcgccatgcctgtttcatt
gcgaccgatgtcggggtggtcgccgagtgccagcggctggtggcgcaggcgatcgagcag
atgggccgtctcgatattctggtcaacaacgctggggtgcagcggcacagcccctttctc
gatgcgggcgaaggcgattacgacctggtgctcaacgtcaatctgcgcgggccgtttttt
ctcgctcaggcgttcgcgcggcatctacgcgacaccggccggggcgggcggatcatcaac
aacagctcggtgcacgaggagctgccgtttccaaacttcaccggctactgcctcagcaag
ggcgggctgaagatgctcatgcgcaacctggcgatcgagctggcgccgctggggatcacc
gtcaataacgtcgcgccgggtgcgatcgagacgccgatcaaccgagccctgatgaaccag
ccggagaagctggccggcctgctgaacaacattcccgccggccgcctcggccagccacgc
gacgtggccggtgccgtggcctttcttgcctcggacgaggccgattacatcaccggtact
acactggtggttgatggcggactgctgtggagttacaccgagcaatga

DBGET integrated database retrieval system