KEGG   Pseudomonas stutzeri 19SMN4: UIB01_02460Help
Entry
UIB01_02460       CDS       T03366                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00020  Citrate cycle (TCA cycle)
pstu00620  Pyruvate metabolism
pstu00650  Butanoate metabolism
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01120  Microbial metabolism in diverse environments
pstu01130  Biosynthesis of antibiotics
pstu01200  Carbon metabolism
Module
pstu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pstu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UIB01_02460
   00620 Pyruvate metabolism
    UIB01_02460
   00650 Butanoate metabolism
    UIB01_02460
Enzymes [BR:pstu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     UIB01_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AHY41381
UniProt: A0A023WMZ5
Position
535373..536884
Genome map
AA seq 503 aa AA seqDB search
MATDLSKYIRNAAFLDKVVSAEEAASWIEDGMTLGMSGFTLFGEPKVFPKALSERGQHEK
FKVNLFTGASMGPAADQSMAEAGIINKRIPYQGNPVQRKKINAGEVLYIDQHLSHTAELL
RQGVLPQVDYAIIEAAAITEDGQIIPTGSVGNSPIFVQNAKHVIIELNTSAPREYEGMHD
IYIPGPAGEDSRKDIPVYNVSKRIGSIGIPVDPAKVRGIVLSSEPDIPSPLFEPNAETQK
IADNLLAFLREEVRLGRLTNSLAPLQSGVGSVANAVLAGMKTSEFKDLTVASEVLQDGVF
DLIDAGVVKFAAATAFSLSKKRVDNLASDLAKYAGKVVFRPQEISNHPEVIRRLGIISFN
TALEVDIYGNVNSTHVNGTHMMNGIGGSGDFARNARISIFVTTSTAKDGKISSIVPFVTH
VDHTNHDVDVIITEQGYADLRGLAPVEAAARIIENCMHPDYKAQALAYLEEAKQRGGHTP
HVLEKAFSWHANFAKNGTMLLDK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgatctaagcaagtacatccgcaatgcagcgtttctcgacaaggtcgtctcg
gcagaagaggccgcgtcgtggatcgaggacggcatgacgctgggcatgagcggtttcacc
ctgttcggggagccgaaagtgtttcccaaggcgctgtccgagcgcggccagcacgagaaa
ttcaaggttaatctgttcaccggcgcatccatggggccggcggccgaccagtcgatggcc
gaagccggcatcatcaacaagcgcatcccgtatcagggcaacccggtgcagcgcaagaag
atcaacgccggtgaggtgctctacatcgatcagcacctgtcgcacaccgccgagctgctg
cgtcagggcgtgctgccgcaggtcgactacgccattatcgaggcggctgcgatcaccgag
gacggtcagatcattccgaccggttcggtcggcaactcgccgatcttcgtgcagaacgcc
aagcacgtgatcatcgagttgaacacttctgctccgcgcgagtacgaaggcatgcacgac
atctacatccccggcccggccggtgaggattcgcgcaaggacatcccggtctacaacgtc
agcaagcgcatcggctcgatcggtattccagtcgatccggccaaggtgcgcggcatcgtg
ctgtccagcgagccggacattccttccccattgttcgagccaaacgccgaaacccagaag
atcgccgacaacctgctggccttcctgcgtgaggaagtgcggcttgggcgcctgaccaac
agcctggcgccgctgcagtccggtgtgggctcggtggccaacgcggtgctggccggcatg
aagacttccgagttcaaggacctgaccgtcgcttccgaagtgctgcaggacggcgttttc
gacctgatcgacgccggggtggtgaagtttgccgccgccaccgccttctccctgtcgaag
aagcgcgtggacaacctggcctctgacctcgccaagtacgccggcaaggtggtgttccgt
ccgcaggagatctccaaccatccggaagtgatccgccgactgggcatcatttccttcaac
accgcgctggaagtcgacatctacggcaacgtgaactccacccacgtcaacggcacccac
atgatgaacggtatcggcggttcgggtgacttcgcccgcaacgcccgtatcagcatcttc
gtgacgacttcgacggcgaaggacggcaagatctcctcgatcgtgccgttcgtcacgcat
gtggatcacaccaaccacgacgtcgacgtcatcatcaccgagcagggctatgccgatcta
cgcggtctggcgccggtcgaggcggcggcgcggatcatcgagaactgcatgcatccggac
tacaaagcccaggcgcttgcatacctcgaggaggcgaagcagcgtggtggccacactccg
catgtgctggaaaaggcgttctcctggcacgccaacttcgccaagaacggcaccatgctg
ctggataagtaa

DBGET integrated database retrieval system