KEGG   Pseudomonas stutzeri 19SMN4: UIB01_03815
Entry
UIB01_03815       CDS       T03366                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00010  Glycolysis / Gluconeogenesis
pstu00071  Fatty acid degradation
pstu00350  Tyrosine metabolism
pstu00620  Pyruvate metabolism
pstu00625  Chloroalkane and chloroalkene degradation
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UIB01_03815
   00620 Pyruvate metabolism
    UIB01_03815
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UIB01_03815
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UIB01_03815
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UIB01_03815
   00626 Naphthalene degradation
    UIB01_03815
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UIB01_03815
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Urocanase Methyltransf_25
Other DBs
NCBI-ProteinID: AHY41635
UniProt: A0A023WPM6
Position
829713..830735
AA seq 340 aa
MTQTMKAAVVHAFGEPLRLEEVKVPMPGPGQILVKIAASGVCHTDLHAAEGDWPVKPALP
FIPGHEGVGHVAAVGAGVTRVKEGDRVGVPWLYTACGCCEHCLTGWETLCEGQQNTGYSV
NGGYAEYVLADPNYVGILPKNVEFDEIAPILCAGVTVYKGLKVTGARPGQWVVISGIGGL
GHVAVQYAKAMGLHVVAVDVDDAKLELAKRLGANLTINARTENPVEVVQRDIGGAHGVLV
TAVSNSAFGQAIGMARRRGTVALVGLPPGDFPTPIFDVVLKAISITGSIVGTRADLQEAL
DFAGEGLVKATIHTDSLDNINQILDDMRAGRIEGRIVLKM
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacccaaaccatgaaagctgcagtcgttcacgccttcggtgagccgctgcgcctcgag
gaagtcaaggtgccgatgcccggcccaggacagatcctggtgaagattgccgcttccggc
gtatgccacaccgacctgcatgccgccgagggcgattggccggtcaagccagccctgccg
ttcattcccggccacgaaggtgtaggtcatgtggcggccgttggcgccggcgtaacacgt
gtcaaggagggtgatcgcgtcggtgtgccctggctgtataccgcctgcggttgctgcgag
cactgcctaaccggctgggaaaccctctgcgagggccagcagaacaccggctattcggtg
aacggtggctacgccgagtacgtgctggctgatccgaactatgtaggcatcctgccgaag
aacgtggagttcgacgagatcgcgccgatcctctgtgctggggtcaccgtctacaagggc
cttaaagtcaccggggcccgacccgggcaatgggtggtgatctccggtatcggcggcctt
ggccatgtcgccgtgcagtacgccaaggccatggggctgcacgtggtggcggtggatgta
gatgatgccaagctcgagctggccaagcgcctgggcgccaatctgaccatcaacgcgcgc
acggaaaaccccgtggaagtggtgcagcgcgacatcggcggtgcccatggcgtgctggtg
accgccgtgtccaacagcgccttcggccaggccatcggtatggcccgccggcgtggcacc
gtggccctggtcggcctgccgccgggagatttcccgacgccgatcttcgatgtggtgctc
aaggcgatcagcatcaccggctccatcgtcggcacccgcgccgacctgcaggaggcactg
gacttcgcgggcgagggactggtcaaggcgaccatccacaccgacagcctcgacaacatc
aaccagatcctcgatgacatgcgcgccggccgcatcgaagggcggatcgtgctgaagatg
tag

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_11555
Entry
UIB01_11555       CDS       T03366                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00010  Glycolysis / Gluconeogenesis
pstu00071  Fatty acid degradation
pstu00350  Tyrosine metabolism
pstu00620  Pyruvate metabolism
pstu00625  Chloroalkane and chloroalkene degradation
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UIB01_11555
   00620 Pyruvate metabolism
    UIB01_11555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UIB01_11555
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UIB01_11555
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UIB01_11555
   00626 Naphthalene degradation
    UIB01_11555
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UIB01_11555
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 Pilus_CpaD Abhydrolase_6
Other DBs
NCBI-ProteinID: AHY43072
UniProt: A0A023WS95
Position
complement(2459242..2460405)
AA seq 387 aa
MSPNISLQRKFVSPEIIFGAGCRHSVGTCAANFGARKVLVVSDPGVVKAGWVADVQASLD
RHHIEHSLFTDVSPNPRCEEVMLGAELYRSEGCNVIVAVGGGSPMDCAKGIGIVAAHGRH
IYEFEGVDTLRVPSPPLILIPTTAGTSADVSQFVIISNQQERMKFSIVSKAAVPDVSLID
PETTLSMDPFLSACTGIDALVHAIEAFVSTGHGPLTDPHALEAMRLINGNLAQMIANPAD
IALREQIMLGSMQAGLAFSNAILGAVHAMSHSLGGYLDLPHGVCNAVLVEHVVAFNYDAS
PDRYRKVAETLGIDSRGLNHRQVRERLVQHLIDLKQQIGFRETLSLHGVNLSDIPFLSQH
AMQDPCILTNPRSSTQRDVEVVYAEAL
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgagcccgaatatcagcctccagcgcaagttcgtctctccagaaatcatctttggtgcc
ggctgtcgccatagtgttggcacctgtgcggccaacttcggtgcgcgaaaggtgctggtg
gtatccgaccccggcgtcgtgaaggcgggctgggtggctgacgtgcaggccagtctagac
cggcatcacatcgaacacagcctgttcactgatgtttcgcccaacccccgctgcgaagag
gtaatgctcggcgccgagctgtatcgcagcgaaggctgcaacgtgattgtcgcagtcggc
ggtggtagccccatggattgcgcgaagggtatcggcatcgtcgcggcgcatgggcgccat
atctatgaattcgaaggggtggatacgctgcgcgtgcccagcccaccgctgattcttatt
ccaacgactgccgggacctcggcagatgtttcacagttcgtgatcatttccaaccagcaa
gagcggatgaagttctccatcgtcagcaaggcagccgtgccggatgtctcgctgatcgac
ccggaaaccacgctcagcatggacccgtttctctccgcctgcaccggcatcgatgcgctg
gtgcacgccatcgaggcattcgtatcgaccggccatggtccgctgaccgacccgcacgcg
ctggaggccatgcgactgatcaacggcaatcttgcgcaaatgatcgccaatccagcggat
attgccctgcgcgagcaaatcatgcttggcagcatgcaggccgggctggcgttctccaac
gcgattctcggcgccgtgcatgccatgtcccacagtctcggcggctacttggatctaccg
catggcgtctgtaatgccgtgctggtcgaacatgtcgtcgccttcaattacgacgcctcg
ccggaccgctaccgcaaggtcgccgaaacccttggcatcgattcgcgcgggctgaatcac
cggcaggtgcgcgaacgtctggtgcagcatttgatcgacctgaagcagcagattggcttc
agggaaacgctcagcctgcacggcgtgaacctctccgatattccgttcctttcgcaacat
gcgatgcaggacccctgcatcctgaccaatccacgctcgtcgacgcagcgggacgtcgag
gtcgtctatgccgaagcgctctga

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_14240
Entry
UIB01_14240       CDS       T03366                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00010  Glycolysis / Gluconeogenesis
pstu00071  Fatty acid degradation
pstu00350  Tyrosine metabolism
pstu00620  Pyruvate metabolism
pstu00625  Chloroalkane and chloroalkene degradation
pstu00626  Naphthalene degradation
pstu00680  Methane metabolism
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01120  Microbial metabolism in diverse environments
pstu01200  Carbon metabolism
pstu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UIB01_14240
   00620 Pyruvate metabolism
    UIB01_14240
  09102 Energy metabolism
   00680 Methane metabolism
    UIB01_14240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UIB01_14240
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UIB01_14240
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UIB01_14240
   00626 Naphthalene degradation
    UIB01_14240
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UIB01_14240
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     UIB01_14240
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 AlaDh_PNT_C MinC_C 2-Hacid_dh_C DUF1304
Other DBs
NCBI-ProteinID: AHY43570
UniProt: A0A023WV40
Position
complement(3048999..3050114)
AA seq 371 aa
MTIKSRAAVAFGPNQPLQIVEVDVAPPKAGEVLVRIVATGVCHTDAYTLSGEDSEGVFPC
ILGHEGGGIVEAVGEGVTSVAVGDHVIPLYTAECRECKFCKSGKTNLCSSVRATQGKGLM
PDGTTRFSYQGEPIYHYMGCSTFSEYTVLPEVSVAKIPKEAPLEKVCLLGCGVTTGIGAV
LNTAKVEEGATVAIFGLGGIGLAAIIGAKMAKASRIIAIDINPSKFAIAEELGATDFVNP
KDYDKPIQEVIVEMTDGGVDYSFECVGNVQLMRAALECCHKGWGESTIIGVAGAGQEIST
RPFQLVTGRVWRGSAFGGVKGRTELPSYVEKAQSGEIPLDTFITHNLPLDKINEAFDLMH
EGKSIRTVIHF
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaccatcaagtcgcgcgccgccgttgccttcggccccaaccagcccctgcagatcgtg
gaagtggacgtcgcgccgcccaaggccggcgaagtgctggtccgtattgttgccaccggg
gtctgtcataccgatgcgtacaccctctcgggcgaggactcagaaggtgtgtttccgtgc
attctcggtcacgagggcgggggcatcgtcgaagcggttggtgaaggcgttacctcggtt
gccgtcggcgatcacgtgatcccgctgtataccgccgaatgccgcgagtgcaagttctgc
aaatccggtaaaaccaacctgtgcagctccgtgcgcgcgactcagggcaaggggctgatg
ccggacggcaccacgcgcttcagctaccagggcgagccgatctaccactacatgggctgt
tcgactttctccgaatacaccgtgctgcctgaagtttcggtggcgaagattccgaaagag
gcgccgctggaaaaggtctgtttgctgggttgcggcgtcaccaccgggattggcgcggtg
ctcaacaccgccaaggtggaagagggcgccacggtggcgatcttcggtctgggcggcatc
ggcctggcggcgatcatcggcgcgaagatggcgaaggccagccggatcatcgccatcgac
atcaacccgagcaagttcgccatcgccgaggagctgggcgcgaccgacttcgtcaatccg
aaggattacgacaagccgatccaggaagtcatcgtcgagatgaccgatggcggcgtggac
tattccttcgagtgcgtcggcaacgtgcagctgatgcgcgcggcgctggagtgctgccac
aagggttggggcgagtcgaccatcattggtgtcgccggtgccgggcaggaaatcagcacc
cgtccgttccagctggtcactgggcgcgtctggcgcggttcggcgttcggcggcgtgaag
ggccgcaccgagctgccgagctacgtggagaaggcgcagagcggcgagattccgctggat
accttcatcacccacaacctgccgctggacaagatcaacgaggcgttcgacctgatgcat
gaaggcaagagcatccgtaccgtcatccacttctaa

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_21940
Entry
UIB01_21940       CDS       T03366                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00010  Glycolysis / Gluconeogenesis
pstu00071  Fatty acid degradation
pstu00350  Tyrosine metabolism
pstu00620  Pyruvate metabolism
pstu00625  Chloroalkane and chloroalkene degradation
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UIB01_21940
   00620 Pyruvate metabolism
    UIB01_21940
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UIB01_21940
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UIB01_21940
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UIB01_21940
   00626 Naphthalene degradation
    UIB01_21940
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UIB01_21940
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Other DBs
NCBI-ProteinID: AHY44998
UniProt: A0A023WY39
Position
complement(4666535..4667518)
AA seq 327 aa
MRAMLLEITGEPLHLRDIPEPQPGPGELRVRVLACGVCRTDLHVVDGELPAAPLPIIPGH
EIVGRVDALGEGVSGFELGQRVGIPWLGHTCGTCSYCQHAEENLCDAPQFTGYTRPGGYA
EYVVADARFAFDLGEQGDAVALAPLLCAGLIGWRSLVKAGDGKRLGLYGFGAAAHIVMQV
ARWQGRDVYAFSRPGDVAAQDFARSLGAVWAGDSGELPPVPLDAAIIYAPAGELVPAALR
AVRKGGRVVCAGIHMSDIPSFPYDILWQERELVSVANLTRQDGLEFFPVAAQVGIHTETH
AYPLEQANQALDDLRHGRFQGAAVLVP
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcgtgccatgttgctggaaataacgggcgaaccgctgcacttgcgtgacattcccgag
ccgcaacccggccctggggagctgcgggtcagagtgctggcctgcggcgtctgtcgcacc
gacctgcacgtggtggatggcgagctgccggcggcgccgctgccgataattcccggccac
gaaatcgttggccgcgtcgatgcgctgggcgaaggcgtcagcggtttcgagctgggccag
cgggtcggcattccctggctcgggcatacctgcggcacctgcagctactgccagcacgcc
gaggaaaacctctgcgacgcgccgcagttcactggttacacccggcccggcggctatgcc
gaatacgtggtggccgacgcgcgcttcgccttcgaccttggcgagcaaggcgatgccgtg
gcactggcgccgctgctctgcgccgggctgatcggctggcgctcattggtcaaggccggc
gacggcaagcgtctcgggctgtacggcttcggcgccgcggcgcatatcgtcatgcaggtg
gcgcgctggcaggggcgtgatgtctacgccttcagccgcccgggcgatgtggccgcgcag
gacttcgcccgttcgctgggtgcggtttgggccggggattcaggggagctgccaccggtg
ccgctggatgcggcgatcatctatgcaccggccggtgagctggtgccggcggcgctgcga
gccgtgcgcaagggcggccgggtggtctgcgccggcatccacatgagtgatattccgagc
ttcccctacgacatcctctggcaggagcgcgaactggtctcggtggccaacctgacccgc
caggacggcctggagttcttcccggtcgccgcccaggtcggcatccataccgagacccat
gcctacccgctggaacaggccaaccaggcgctggatgacctgcgccatgggcgctttcag
ggtgctgcggtgctggtgccgtaa

DBGET integrated database retrieval system