KEGG   Pseudomonas stutzeri 19SMN4: UIB01_07575Help
Entry
UIB01_07575       CDS       T03366                                 

Definition
(GenBank) SAM-dependent methlyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pstu03009]
    UIB01_07575
Enzymes [BR:pstu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     UIB01_07575
Ribosome biogenesis [BR:pstu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    UIB01_07575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS Methyltransf_32 Methyltransf_4 Ubie_methyltran Methyltransf_18 Methyltransf_33 Methyltransf_2 MetW PCMT
Motif
Other DBs
NCBI-ProteinID: AHY42347
UniProt: A0A023WQ48
Position
complement(1591184..1591990)
Genome map
AA seq 268 aa AA seqDB search
MLICPICQAPLSAVDNGVACPANHRFDRARQGYLNLLPVQHKNSRDPGDNQAMVEARRRF
LNGAHYAPLARRLADLAAERTPQRWLDIGCGEGYYTAQLAEALPDAEGYALDISREAVKR
ACKRAPQLEWLVASMARVPLADASCDLLASVFSPLDWQEARRLLAPGGGLLRMGPTRDHL
WELRARLYDEVRDYDDEKHLSLIPEGMRLAHSETLCYELQLDDAQARADLLAMTPHGWRA
SAERRAAVIDSHLSVRVAIRYDWIERTA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgctgatctgcccgatctgccaggcgccgctcagcgcggtcgacaacggcgtggcctgt
ccggccaaccaccgttttgatcgcgcgcgccagggttacctgaacctgctcccggtacag
cacaagaacagtcgcgaccccggcgacaaccaggccatggtcgaggcacgccggcgcttt
ctcaacggtgcccattacgcaccgctggcccggcgcctggctgaccttgccgccgagcgt
acgccgcagcgctggctcgacatcggctgtggcgagggctactacaccgcacagctcgcc
gaagcgctgccggatgccgaaggctatgcactggacatctcccgtgaagcggtcaagcgc
gcctgcaaacgcgcaccgcagctcgaatggctggtcgcaagcatggcgcgtgttccgctg
gccgatgccagctgcgacctgctcgccagcgtgttcagcccgctggactggcaggaggcg
cgacgcctgctcgcgcccggcggcggtctgctgcgcatggggccgacccgcgaccatttg
tgggagcttcgcgcgcggctctacgacgaggtgcgcgattacgacgacgagaaacacctg
tcgttgatccctgaaggcatgcgcctggctcatagcgaaaccctctgctacgagctgcaa
ctggacgatgcccaggcccgtgccgatctgctggcgatgaccccgcacggctggcgcgcc
agcgccgaacgccgcgccgcagtgatcgacagtcacctcagcgtgcgggttgcgatacgc
tacgactggatcgaacgcacagcgtag

DBGET integrated database retrieval system