KEGG   Pseudomonas stutzeri 19SMN4: UIB01_12425Help
Entry
UIB01_12425       CDS       T03366                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00071  Fatty acid degradation
pstu00072  Synthesis and degradation of ketone bodies
pstu00280  Valine, leucine and isoleucine degradation
pstu00310  Lysine degradation
pstu00362  Benzoate degradation
pstu00380  Tryptophan metabolism
pstu00620  Pyruvate metabolism
pstu00630  Glyoxylate and dicarboxylate metabolism
pstu00640  Propanoate metabolism
pstu00650  Butanoate metabolism
pstu00900  Terpenoid backbone biosynthesis
pstu01100  Metabolic pathways
pstu01110  Biosynthesis of secondary metabolites
pstu01120  Microbial metabolism in diverse environments
pstu01130  Biosynthesis of antibiotics
pstu01200  Carbon metabolism
pstu01212  Fatty acid metabolism
pstu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UIB01_12425
   00630 Glyoxylate and dicarboxylate metabolism
    UIB01_12425
   00640 Propanoate metabolism
    UIB01_12425
   00650 Butanoate metabolism
    UIB01_12425
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UIB01_12425
   00072 Synthesis and degradation of ketone bodies
    UIB01_12425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UIB01_12425
   00310 Lysine degradation
    UIB01_12425
   00380 Tryptophan metabolism
    UIB01_12425
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UIB01_12425
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UIB01_12425
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UIB01_12425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pstu04147]
    UIB01_12425
Enzymes [BR:pstu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UIB01_12425
Exosome [BR:pstu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UIB01_12425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHY43236
UniProt: A0A023WTC4
Position
complement(2657862..2659046)
Genome map
AA seq 394 aa AA seqDB search
MKDDPIVIVSSARTPMGGFQGDLLGMTAPQLGAAAIRAAVERSGLPAENVQDALMGCVLP
AGQGQAPARQAALGAGLTRATTCTTLNKMCGSGMQTVIMAHDQLLAGSAEIVVAGGMESM
SNAPYLLDRARGGYRMGHGRVLDHMFLDGLEDAYDKGRLMGTFAEECADVFGFTREEQDA
FALESLRRAQAAIAEGHFAEEIVSLDVTQGKQQRQIRDDEQPPKAMPEKIPSLRPAFREG
GTVTAANSSSISDGAAALLLMRRSEAERWGLQPQAVIHGHAAYADAPNLFTTAPIGAIRK
LMERTGWSTADVDLFEINEAFAVVAMASMRELGLDHAKVNVNGGACALGHPIGASGARIL
VTLLAALRKRGLRRGVAAICIGGGEATAMAVELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgatccgatcgtaatcgtcagcagcgcgcgtacgccgatgggtggtttccag
ggtgatctgctgggcatgacggcaccgcagctcggcgctgccgccatccgcgcggcggtg
gagcgcagcggcctgccggccgagaacgtacaggacgcgctgatgggctgcgtgttgccc
gccggccagggccaggctcccgcgcgccaggcggcattgggcgccgggctgacccgcgcc
accacctgcaccacgctgaacaagatgtgcggctcgggcatgcagacggtgatcatggct
cacgaccagttgctcgcgggcagtgcggaaatcgttgtcgccggtggcatggagagcatg
agcaacgcaccgtacctgctcgaccgcgcccgtggcggctatcgcatgggccacggtcgg
gtgctcgaccacatgtttctcgatggtctggaagacgcctacgacaagggccgcctgatg
ggcacctttgccgaggagtgcgccgacgtcttcggcttcacccgcgaggagcaggacgcg
ttcgcactggaatcgctgcgacgggcccaggcggcaatagccgaagggcactttgccgaa
gagatcgtctcgctggacgtcactcagggcaaacagcagcggcagatccgcgatgatgag
cagccgcccaaggcgatgccggaaaagattccaagcctgagaccagcgttccgcgagggc
ggcacggtgactgcggccaactccagctcgatttccgatggcgccgccgcgctgctgttg
atgcgccgttccgaagccgagcgctgggggctgcagccacaggcggtgatccacggccac
gcggcctacgccgatgcgccgaatctgttcactaccgcgccgatcggggcgatccgcaag
ctgatggaacgtaccggctggtccaccgcagacgtggatctgttcgagatcaacgaagcc
ttcgcggtggtcgccatggccagcatgcgcgagctggggcttgatcacgccaaggtcaac
gtcaacggcggtgcctgtgcgctcggtcaccccatcggtgcgtccggtgcgcgaatcctg
gtgacgttgctcgccgcattgcgcaaacgcggcctgcgccgtggcgtggcggcgatctgc
atcggtggcggtgaagccacggccatggccgtcgaactgatctga

DBGET integrated database retrieval system