KEGG   Pseudomonas stutzeri 19SMN4: UIB01_18555Help
Entry
UIB01_18555       CDS       T03366                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
pstu  Pseudomonas stutzeri 19SMN4
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    UIB01_18555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHY44359
UniProt: A0A023WWZ9
Position
3910935..3911318
Genome map
AA seq 127 aa AA seqDB search
MSDDNRYRIDVSVTPRYLAAQSEPEQNRYAFAYTVTIENNGEVAAQLLSRHWIITDGDGQ
VQEVRGAGVIGEQPLIAPGEYHVYTSGTLLATCVGSMQGSYEMLAEDGHKFDALIAPFRL
AVPGALH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgataaccgctaccgcatcgacgtcagcgtcacgcctcgctatctggccgcg
caatcggagccggaacaaaaccgttatgcctttgcctacaccgtaaccattgaaaacaat
ggcgaggtggcggcgcagctgctgtcgagacactggatcatcaccgatggtgatggccaa
gtgcaggaagtgcgtggcgccggcgtcattggcgagcagccgctgatcgctcctggcgaa
taccacgtttacaccagcggaacactgctggcgacctgcgtcggcagcatgcagggcagc
tatgagatgttggccgaggatggtcacaaattcgatgcgctcattgcgccgttccgcctt
gccgtacccggagcattgcattga

DBGET integrated database retrieval system