KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22615
Entry
UIB01_22615       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14581  naphthalene 1,2-dioxygenase ferredoxin reductase component [EC:1.18.1.7]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu00627  Aminobenzoate degradation
pstu00633  Nitrotoluene degradation
pstu00642  Ethylbenzene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UIB01_22615
   00633 Nitrotoluene degradation
    UIB01_22615
   00642 Ethylbenzene degradation
    UIB01_22615
   00626 Naphthalene degradation
    UIB01_22615
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22615
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.7  ferredoxin---NAD(P)+ reductase (naphthalene dioxygenase ferredoxin-specific)
     UIB01_22615
SSDB
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 NAD_binding_6 FAD_binding_8
Other DBs
NCBI-ProteinID: AHY45192
UniProt: Q9ZI75
Position
pLIB119:50930..51916
AA seq 328 aa
MELLVLPNNRRLPFDSGANLLEVLREHRVGISYSCMSGRCGTCRCRVIDGSVISSAAKSG
DSNRIEEHYVLACQSVLTSNCAIEIIDSDDIVTHPARIIKGMVVAVESPTHDIRRIRIRL
AKPFEFSPGQYATLQFSPEHVRPYSMAGLPDDQEMEFHIRKVPGGRVTEYIFEHVREGTS
IKLSGPLGTAYLRQAHTGPMLCVGGGTGLAPVLSIVRGALKSGMTNPIHLYFGVRSQQDL
YDADRLNQLAAIHPQLTVHTVIATGPINEGQRAGLITDLIEKDIPSLAGWRAYLCGAPAM
VDALCTVAKVLGISPEHIYADAFYPSGV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggaacttctcgtactaccgaacaatcgccgcttgccttttgattccggtgccaacctt
ttggaagtgctccgtgagcaccgtgtgggtatttcctacagctgtatgtctggacgatgc
ggtacttgccgctgccgagttatagatggcagcgtcattagttcggcggcgaaaagcggt
gactcaaatcgcatcgaagagcattatgtactcgcctgtcagtcagtgctcaccagcaat
tgcgcaattgagatcatagactcagacgacatagtcactcacccggcgcgaatcatcaaa
ggcatggttgtcgccgtcgagtcgcccactcacgatattcgtcgcatccgcattcgcctc
gccaagccctttgagttctcacccggacagtacgcgacgctacagttcagtcccgaacat
gtgcgtccatattcaatggctggtctgccagatgaccaagaaatggagttccatatccgc
aaagtgccgggcgggcgtgtcacggagtatattttcgagcacgtccgcgaaggtacaagc
attaagttgagtgggcctcttggtacggcctatctgcgtcaggctcacaccgggccgatg
ctgtgtgtgggcggcgggaccggactcgcaccggtgctgtcgattgttcgcggcgcgctg
aagtcgggaatgacgaaccccatccacctttatttcggggtgcgcagtcagcaagacctt
tacgacgcagaccgattgaaccaactcgcggctatccaccctcaactgactgtccataca
gtgatcgcgacgggcccgattaatgagggccagcgagccggcctaattaccgatttgatt
gaaaaagacattccctcgctggctgggtggagagcctacctgtgcggcgcaccagcgatg
gttgacgctctatgcaccgtcgccaaagttcttggaatatcgcccgaacatatttatgcc
gatgccttctatcccagcggggtctga

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22620
Entry
UIB01_22620       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14578  naphthalene 1,2-dioxygenase ferredoxin component
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu00627  Aminobenzoate degradation
pstu00633  Nitrotoluene degradation
pstu00642  Ethylbenzene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UIB01_22620
   00633 Nitrotoluene degradation
    UIB01_22620
   00642 Ethylbenzene degradation
    UIB01_22620
   00626 Naphthalene degradation
    UIB01_22620
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22620
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AHY45193
UniProt: A0A023WYN5
Position
pLIB119:52060..52374
AA seq 104 aa
MTEKWIDAVALYEIPEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGAARMSDGFLEGR
EIECPLHQGRFDVCTGRALCAPVTQNIKTYPVKIEGQRVMIDLS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgacagaaaaatggattgacgcagtcgctctttatgaaatccctgaaggtgacgtcctc
ggcgtgacagtcgaaggcaaggaactagcgctgtatgaagtggaaggcgaaatctacgct
accgacaacctgtgcacacatggtgctgcccgcatgagtgatggctttctagaaggcaga
gaaattgaatgtcctttgcatcaaggtagatttgatgtttgcacaggcagggccttgtgc
gcccctgtgacacagaacatcaaaacatacccggtgaagattgagggccagcgtgtgatg
attgatttgagctga

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22625
Entry
UIB01_22625       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu00627  Aminobenzoate degradation
pstu00633  Nitrotoluene degradation
pstu00642  Ethylbenzene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UIB01_22625
   00633 Nitrotoluene degradation
    UIB01_22625
   00642 Ethylbenzene degradation
    UIB01_22625
   00626 Naphthalene degradation
    UIB01_22625
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22625
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     UIB01_22625
    1.14.12.23  nitroarene dioxygenase
     UIB01_22625
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     UIB01_22625
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AHY45194
UniProt: A0A023WZF5
Position
pLIB119:52444..53793
AA seq 449 aa
MNYKNINLVSESGLTQKHLIHGDEELFQRELETIFARNWLFLTHDSLIPSPGDYVTAKMG
VDEVIVSRQNDGSIRAFLNVCRHRGKTLVHAEAGNAKGFVCSYHGWGFGANGELQSVPFE
KELYGEALDKKCMGLKEVARVESFHGFIYGCFDEEAPSLKDYMGDAGWYLEPMFKHSGGL
ELIGPPGKVIIKANWKAPAENFVGDAYHVGWTHAASLRTGQSVFSSLAGNAALPPEGAGL
QMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGEVRARIYRSHLNGTV
FPNNSFLTCSGVFKVWHPIDANTTEVWTYAMVEKDMPEDLKRRLVDAVQRTFGPAGFWES
DDNDNMETESQNAKKYQSRDGDLVSNLGFGGDVYGDEVYPGIVGKSAIGETSYRGFYRAY
GAHISSSSWAEFEDVSKNWHTELAKTTDR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaattacaaaaatataaacttggtgagtgaatctgggctgacccaaaaacacctgatt
catggcgacgaagaacttttccagcgcgaactggaaaccatttttgctcggaactggctt
ttcctgactcatgacagcctgattccgtcccctggcgactatgttacggcaaaaatgggg
gttgatgaggttatcgtctccaggcagaacgacggttcgattcgtgctttcctgaacgtt
tgtcgtcaccgtggcaagacgctggtacacgcagaagcaggtaatgctaaaggtttcgtt
tgcagctatcacggctggggcttcggcgctaacggtgaactgcagagcgtcccgtttgaa
aaagaactgtatggcgaggcgctcgacaagaaatgtatgggattgaaagaagtcgctcgt
gtagagagcttccatggcttcatctatggttgcttcgatgaggaagccccttctctcaaa
gactacatgggggacgctggctggtacctggagcctatgtttaagcattccggagggcta
gaactgatcggtcctccaggcaaggtcataatcaaggctaactggaaagcgcccgcggaa
aactttgtgggggatgcgtaccacgtgggttggacgcatgcggcttcgcttcgcacaggg
cagtcggtcttctcgtcgttagctggcaacgcagctttgcccccagaaggtgcaggtctg
caaatgacctccaaatacggcagcggcatgggtgtgttgtgggacggatattcaggcgtg
cacagcgcagacctggttccggaattgatggccttcggcggtgctaagcaggaacggctg
aacaaagaaattggcgaggttcgcgcacgaatctatcgtagccacctcaacggcaccgtt
ttcccgaacaacagttttctgacctgctcgggtgtcttcaaggtatggcacccgatcgac
gcaaataccactgaggtatggacctacgccatggtcgaaaaagacatgcccgaggatctc
aagcgccgcttggtcgacgcggttcagagaacgtttgggcctgctggcttctgggaaagc
gacgacaacgacaatatggaaacggaatcgcaaaacgccaagaaatatcagtccagagat
ggcgatctggtttccaacctgggtttcggcggggacgtatacggcgacgaggtttatcct
ggcatcgtcggcaaatcggcgattggcgagaccagttatcgtggcttctatcgggcttac
ggcgcgcacatcagcagctctagctgggctgaattcgaggatgtctctaaaaattggcat
accgaactggcaaagactactgatcgctaa

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22630
Entry
UIB01_22630       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu00627  Aminobenzoate degradation
pstu00633  Nitrotoluene degradation
pstu00642  Ethylbenzene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UIB01_22630
   00633 Nitrotoluene degradation
    UIB01_22630
   00642 Ethylbenzene degradation
    UIB01_22630
   00626 Naphthalene degradation
    UIB01_22630
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22630
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     UIB01_22630
    1.14.12.23  nitroarene dioxygenase
     UIB01_22630
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     UIB01_22630
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: AHY45195
UniProt: Q9ZI72
Position
pLIB119:53809..54390
AA seq 193 aa
MMINIQEDKLVSAHDAEEFLRFLNSGDEALQQEATTLLTREAHLLDIQAYRAWLEHCVDS
EVKYQIISRELRSASERRYQLNETMNIFNENYEQLEVRVAHQLDPQNWGNSPKVRFTRFI
TNIQAAMDENEDLLHIRSNLIVHRARRGNQVDVFYATREDKWKRGEDGARKLVQRLIDYP
ERTFQTHNVMIFM
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatgattaatattcaagaagacaagcttgtctccgcccacgatgccgaagagtttctt
cgtttcttaaattccggcgacgaggctttgcaacaagaagctaccacgttgctaacccgg
gaagcgcatcttttagacattcaggcttaccgcgcctggttagagcactgcgtggactca
gaggtgaaatatcagattatctcacgcgaactgcgctcagcttccgagcgccgttaccag
ctcaatgaaaccatgaacattttcaacgagaattatgaacaactggaagttcgcgtagcg
catcaactggatccgcaaaactggggcaatagtccaaaggtgcgctttactcgtttcatc
acaaatatccaggctgcaatggacgaaaatgaagatttgcttcacattcgctccaaccta
attgttcaccgagcacgacgcggcaatcaagtcgatgtcttctatgccactcgggaggat
aaatggaagcgcggcgaagatggagcgcgtaagttggtccaacgattgattgattatcca
gagcgcacattccagacgcacaatgtgatgatctttatgtga

DBGET integrated database retrieval system