KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22620
Entry
UIB01_22620       CDS       T03366                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14578  naphthalene 1,2-dioxygenase ferredoxin component
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu00627  Aminobenzoate degradation
pstu00633  Nitrotoluene degradation
pstu00642  Ethylbenzene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UIB01_22620
   00633 Nitrotoluene degradation
    UIB01_22620
   00642 Ethylbenzene degradation
    UIB01_22620
   00626 Naphthalene degradation
    UIB01_22620
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22620
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AHY45193
UniProt: A0A023WYN5
Position
pLIB119:52060..52374
AA seq 104 aa
MTEKWIDAVALYEIPEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGAARMSDGFLEGR
EIECPLHQGRFDVCTGRALCAPVTQNIKTYPVKIEGQRVMIDLS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgacagaaaaatggattgacgcagtcgctctttatgaaatccctgaaggtgacgtcctc
ggcgtgacagtcgaaggcaaggaactagcgctgtatgaagtggaaggcgaaatctacgct
accgacaacctgtgcacacatggtgctgcccgcatgagtgatggctttctagaaggcaga
gaaattgaatgtcctttgcatcaaggtagatttgatgtttgcacaggcagggccttgtgc
gcccctgtgacacagaacatcaaaacatacccggtgaagattgagggccagcgtgtgatg
attgatttgagctga

DBGET integrated database retrieval system