KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22695
Entry
UIB01_22695       CDS       T03366                                 

Definition
(GenBank) monooxygenase
  KO
K00480  salicylate hydroxylase [EC:1.14.13.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00621  Dioxin degradation
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    UIB01_22695
   00626 Naphthalene degradation
    UIB01_22695
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22695
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.1  salicylate 1-monooxygenase
     UIB01_22695
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 NAD_binding_8 Pyr_redox Amino_oxidase FAD_binding_2 Trp_halogenase NAD_binding_9 DAO 3HCDH_N HI0933_like Lycopene_cycl
Other DBs
NCBI-ProteinID: AHY45207
UniProt: A0A023WYA5
Position
pLIB119:complement(66450..67868)
AA seq 472 aa
MWEMAGARCSRRLKIQKKWMIRSFFRRIAAFKIGRAEVSQKYVTTSDHPYKKEIIIMNEK
ETNKIRRIAVVGGGIGGLTFAIAMRHHGIDVDIYEQAEELREVGAAVALSANATRFYYNH
WGLGEEFDEAAFEISALIYRDGKTGREIGRHAGGLAYRDLFGGPYLGIHRAELQRILSTK
VGMERIHLNKRLVNIDDTGEQVVLHFKDGSKAEADIVIGADGMRSTVRNLMLGYEDYIYA
GYTAFRGIVPIDKIPSMPDPTAIQFWMGESGHCLHYPIGGDRKGDINFFLVERTPTTWPL
KQSTAPTDDGEQLRLFKDWHPALVEMIASNTLKTVNQRWGMVYRMTLGRWSKGRVTLLGD
AAHSLVPHHGQGANQSIEDAVVLADCIAAAGSASIAETFERYERLRRGRARKVVYASVTT
GDMLHLPPGEERDRRDARLASHDAMVHHLDWIHGFDASDLNEPDERQGGTWL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgtgggaaatggccggcgcgaggtgctcgcggcggctaaaaatccagaaaaaatggatg
attcgatcgttttttagacgaatcgccgcttttaaaattggcagggctgaagtcagccag
aaatacgtgactacttcagaccatccttataagaaagagataataattatgaatgaaaaa
gaaaccaataaaatacgccgcattgctgtggtcggtggcggcatcggtggcttgaccttt
gcgattgcgatgcgccaccacggtatcgacgttgatatatacgagcaagcggaggagttg
cgtgaggtgggtgccgcggtcgcattatccgccaatgccacgcgtttttattataaccac
tggggtttgggcgaggagtttgacgaggctgcgtttgaaatctctgctttgatctaccgg
gacggaaagactggccgtgaaatcggcaggcacgccggcgggctggcgtatcgagacctt
ttcggcggcccatatctcggcatccaccgggccgagttgcaacgaatcctctccaccaag
gtgggtatggaacgcatccacctgaataaacgcctagtaaatatcgatgacactggcgaa
caggtagtgttacattttaaggatggcagcaaagcggaagccgatatagtcatcggtgct
gacgggatgcgttccaccgtacggaatttgatgctcggctatgaagattacatatacgcg
gggtacacagcatttcgtgggattgttccaatcgataaaataccgagcatgcctgatccg
accgctattcaattctggatgggtgagtccggccactgtcttcactacccgatcggcgga
gacagaaaaggagacatcaatttctttctcgtagagcgcactccgacgacttggccacta
aaacagtcgactgcgcctacagacgacggtgaacagctacgcctcttcaaggactggcat
cctgctctcgtcgagatgatcgcttcgaacaccttgaagacagtaaatcagcgatgggga
atggtttatcgtatgacccttggccgctggagcaaaggtcgggtaacgctgctcggtgat
gctgcacattccctagtaccgcaccatggacagggtgccaaccagtcgatcgaggatgcc
gtggtccttgctgactgcattgccgctgcgggttccgcgtcgattgcagaaacctttgaa
cgttacgagcgactgcgtcgtggccgggcgcgcaaagttgtgtatgcgtccgtgaccact
ggcgatatgttgcacttgccaccgggtgaagagagggatcggcgcgatgcacgtcttgca
tctcatgatgccatggtgcatcacctcgattggatccacggcttcgatgctagcgatctc
aacgagccggatgaacgccagggcggcacctggttgtga

KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22720
Entry
UIB01_22720       CDS       T03366                                 

Definition
(GenBank) salicylate hydroxylase
  KO
K00480  salicylate hydroxylase [EC:1.14.13.1]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00621  Dioxin degradation
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    UIB01_22720
   00626 Naphthalene degradation
    UIB01_22720
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22720
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.1  salicylate 1-monooxygenase
     UIB01_22720
SSDB
Motif
Pfam: FAD_binding_3 NAD_binding_9 DAO NAD_binding_8 Pyr_redox_2 Trp_halogenase Lycopene_cycl Thi4 Pyr_redox HI0933_like FAD_binding_2 Gp138_N
Other DBs
NCBI-ProteinID: AHY45210
UniProt: A0A023WZM3
Position
pLIB119:70580..71893
AA seq 437 aa
MNDMNAKKPALRVAIVGGGISGLALALSLCKHSHLNVQLFEAAPAFGEVGAGVSFGPNAV
RAIVGLGLGQSYFQVADRTPQPWEDIWFEWRRGSDASYLGATIAPGVGQSSVHRADFLDA
LVRHLPEGIAQFRKRATQIEQQGDELQVLFADGTEYRCDLLIGADGIKSALRSYVLEGQG
LDHLEPRFSGTCAYRGMVDSLQLREAFRIKGIDEHLVDVPQMYLGLDGHILTFPVRKGRI
VNVVAFTSDRSQPEPTWPADAPWVREASQREMLDAFAGWGDAPRALLECIPAPTLWALHD
LPELPGYVHGRVALIGDAAHAMLPHQGAGAGQGLEDAYFLARLLGDSRTETGNLPELLGA
YDDLRRPHACRVQRTTVETGELYELRDPIVGADEQLVGEILATRFDWLWNHDLDADVAEA
RLRMGWEAHEQIALRQG
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaacgacatgaacgctaagaaaccagccttgcgcgtcgctatagtcggcggcggaatt
tcaggccttgccttggcattgagcttgtgcaaacactcccatcttaatgtgcagctattc
gaggctgccccggcgttcggtgaagtcggtgctggtgtgtccttcgggcctaacgcagtg
cgcgccattgtcggtttgggtttgggtcaatcctactttcaggttgctgatcggactccg
cagccttgggaggatatttggtttgaatggcggcgcggtagcgatgctagctatctaggc
gccaccattgcgccgggcgtaggtcagtcctctgtacaccgggctgatttccttgacgcc
ctagtaagacaccttccagaaggtatcgcccaatttaggaagcgtgccacccaaatcgag
cagcagggtgatgaactgcaagtgctattcgccgacggcacagagtaccgctgcgatctt
ctaatcggcgccgacggcattaagtcagcgcttcgtagctatgtgctggaaggtcagggg
ctggatcatctagaaccacgttttagcggtacctgtgcataccggggcatggtagatagc
ctgcaactgcgcgaagcctttagaataaagggcattgacgagcacttggtggatgtcccg
cagatgtacttagggctcgatggccatattcttaccttcccggtgagaaaaggccgcatt
gtcaacgtggtagcgttcacctccgaccgtagccagccggaaccgacttggcccgcggac
gctccctgggtacgggaagcgagccagcgcgagatgctcgatgcgttcgcgggctggggc
gatgccccgcgcgccttactggagtgcatcccggcgccaactctctgggcactgcatgac
ctgccggaactgccaggctacgtacacggtcgggttgccctgatcggcgacgcagcgcac
gccatgctgccgcaccaaggggccggtgcagggcaagggcttgaggacgcctatttcctc
gcccggctgttgggcgatagtcggaccgaaacaggcaacctccccgagctgcttggagct
tacgacgacctgcgccgccctcatgcctgtcgtgtgcaacgaaccactgtggaaaccggc
gagttatacgagttgcgcgaccccattgtaggtgcggacgaacagctggtgggggaaata
ctggcgactcgtttcgactggctatggaaccatgatctcgatgccgatgtggctgaggcc
cgactgcgcatgggctgggaggcgcatgagcaaattgcgctgcgtcaagggtaa

DBGET integrated database retrieval system