KEGG   Pantoea stewartii subsp. stewartii: DSJ_00210Help
Entry
DSJ_00210         CDS       T04970                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00010  Glycolysis / Gluconeogenesis
pstw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSJ_00210
Enzymes [BR:pstw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DSJ_00210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase PerC HAD SHOCT
Motif
Other DBs
NCBI-ProteinID: ARF47954
UniProt: H3RIJ6
Position
complement(44704..45300)
Genome map
AA seq 198 aa AA seqDB search
MLYIFDLGNVIIDIDFNRVLGVWSDLSRVPLASLQSHFQMDAAFEQHERGEISDEAFAEA
LCEKLEIALSYEQFAAGWQAIFVGVRPDTLALMNQLRQAGHRVVILSNTNALHCTFWPTQ
YPDVQQAADKIYLSQELGMRKPEARIYQHVLDAEGFSADQAVFFDDNAANIEGARALGIT
SVLVTDSKTVPDWFAGQP
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttgggcaatgtgattatcgatatcgactttaaccgcgtgttg
ggcgtctggagtgacctcagccgcgtaccgctggcatcgcttcaaagtcattttcaaatg
gatgcggcttttgagcagcatgagcgcggtgaaatcagcgatgaagcctttgcagaagcc
ttatgtgaaaaactggagattgcgctgagctatgaacagtttgctgcgggctggcaggct
atctttgtgggagtgcgtccggatacgctggcgctgatgaatcagctacgccaggcagga
catcgggtggtgatattgtcgaataccaatgcactgcattgcaccttctggccgacccag
tatcctgatgtgcagcaggcggctgacaagatttatctgtcccaggaactgggcatgcgt
aaacctgaagcccgcatttatcagcacgtactggatgcggaaggattcagtgccgatcag
gccgtcttcttcgacgacaatgccgccaatattgaaggtgcgcgcgcattaggcattacc
agcgtgctggtgaccgacagtaaaaccgtgcccgactggttcgcgggtcagccttaa

DBGET integrated database retrieval system