KEGG   Pantoea stewartii subsp. stewartii: DSJ_07975Help
Entry
DSJ_07975         CDS       T04970                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pstw  Pantoea stewartii subsp. stewartii
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DSJ_07975
Enzymes [BR:pstw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DSJ_07975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ARF49282
UniProt: H3RAJ1
Position
1654028..1654825
Genome map
AA seq 265 aa AA seqDB search
MKVALGQFVVKREWQENAQACINMMAQAREASADLLVLPEAVLATDMTNPDWIREAAQPL
NGPFLTQLLTASQGQTLTTVFGMHVPGDSHKVFNVLVVIRDGKILAEYRKLHLYDAFSMQ
ESARVEAGQDVPPLVPVAGMNVGLMTCYDVRFPEMARRLVLDGADVLVVPSAWVRGPLKE
MHWDLLTRTRALENTCYVLAVGECGARNIGNSMVIDPLGVPISRAAESPALIVADLDPQR
IAAARALLPVLENRRFARPELDPAR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgcgctgggtcagtttgtcgttaaacgggaatggcaggagaatgcgcaagcc
tgtataaacatgatggcacaagcccgggaagccagcgccgatctgctggtgctaccggag
gccgtgctggccacagatatgaccaaccctgactggatacgggaagcggcccaaccgctg
aacggcccgtttctgacccagttactgaccgccagccaggggcagacgctgacgaccgtg
ttcgggatgcatgtgccgggcgacagccataaagtctttaacgttctggtagtcattcgc
gacggcaagattctggcggaataccgcaagctgcatctgtacgacgccttttcaatgcag
gaatcggcgcgggttgaggccggtcaggacgtgccgccgttggtgcccgtggcgggcatg
aacgttgggctgatgacctgctatgacgtgcggtttccggaaatggcacgacgtctggtg
ctggatggtgctgacgtgctggtcgtgccatcagcgtgggtcagaggaccgctaaaagag
atgcactgggatttactcacccgaacgcgagcgctggaaaatacctgttatgtattggcg
gtgggcgagtgcggcgcacgtaatattggcaacagtatggtgatcgatccgctgggcgta
cccataagtcgcgccgcggagtcgcctgctttgatcgttgccgatctggacccacagcgc
attgcggcggcgagggctctgctgccggtgctggagaaccgtcgctttgcccggccagag
ctggatccggcgcgttga

DBGET integrated database retrieval system