KEGG   Pantoea stewartii subsp. stewartii: DSJ_08650Help
Entry
DSJ_08650         CDS       T04970                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pstw  Pantoea stewartii subsp. stewartii
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DSJ_08650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2627
Motif
Other DBs
NCBI-ProteinID: ARF49396
UniProt: H3RAZ9
Position
complement(1783934..1785538)
Genome map
AA seq 534 aa AA seqDB search
MSENSLSSSGTTQGRPDFNGKGSRATKTAFYVLLIAGLAFAGFNLFHDVEKTNTPVTSYV
PFFLLGLALLIALGFEFVNGFHDTANAVATVIYTHSLTPGAAVVWSGLCNFLGVMLSSGV
VAFGIISLLPVELILQASSGNGFAMIYALLFSAIIWNLGTWYFGLPSSSSHTLIGSIIGV
GVANAMLHGRSGLSGVDWDQALKVGYALLLSPVVGFVCAALLLWAMKLLIRNRQLYEAPH
SNEPPPVWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTMPIAYALNRSLPPEQIP
RVAALSDVTARQLLHIQPAATPAPDSRNVLTAFVSTDTVNPNVLPALGMTLRDISDQIRR
YGSMDNIPAQSVTNTRNQMYLAAESIKHLQTAHVSLPDETARNLKAVKTELDSATRFIPM
WVKVVVAIALGLGTMVGWRRIVVTVGERIGKTHLTYAQGASAELVAMATIGAADAFGLPV
STTHVLSSGVAGTMAANRSGLQMSTLRNLAVAWILTLPVSILLSALLYGLFIHI
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacagtttatcctcttcaggcacgacgcagggacgtcccgatttcaacggc
aaaggcagccgcgcaaccaaaacggctttttatgtcctgttaatagccggtctggccttt
gccggatttaatctgtttcacgatgtggaaaaaactaacacgcccgtcaccagttatgtg
cctttctttctgctcggcctggcgctgctgattgcgctgggctttgaattcgttaacggg
tttcacgataccgccaacgcggtcgctacggtgatctacacgcattcgctgacgcccggt
gcggccgtcgtctggtcagggctgtgcaactttcttggcgtgatgctttccagcggcgtg
gtcgcgtttggcattatttcgcttctgcccgtcgaactcatcctgcaggccagcagcggc
aacggctttgccatgatttacgccctgctgttctcggcgattatctggaatctgggcacc
tggtactttggcctgccctcgtcgtcgtcacatactttaattggctcgattattggcgta
ggtgtggcgaatgcgatgttgcatggtcgcagtggcctgagtggcgttgactgggatcag
gcgctgaaggtcggctatgccttactgctctcgcccgtcgtgggcttcgtctgcgccgcc
ctgctgctgtgggccatgaagctgttgattcgtaaccgccagttgtacgaagccccgcac
agcaacgagccgccgccggtctggattcgtggcctgctgattctgacctgcaccggcgtc
tcctttgctcacgggtcgaatgacgggcagaaagggatgggactcatcatgctgatcctg
gtcggcaccatgcccatcgcctatgcactgaaccgttcacttccgcccgagcaaatcccg
cgcgttgccgcactgagtgacgtgacggcgcgccagttactgcatattcaaccggccgcc
acgcccgccccggattcacgcaatgtgttgacggcctttgtcagcactgacacggtcaat
ccgaacgtcttgcccgcgcttggcatgacgttacgggatatcagcgaccagattcgccgc
tacggctcgatggacaatattccggcccagtccgtgaccaatacccgcaatcaaatgtac
ctggccgcagaatcgatcaagcacctgcaaaccgcccatgtctcgctccccgatgagacg
gcacgtaacctgaaggcggtgaaaacagagctggacagcgccacacgctttattccgatg
tgggtgaaggtggtggtggcaatcgcgttggggctgggcaccatggtgggctggcgacgt
attgtggtcaccgtgggtgagcgcatcggcaaaacccatctgacctatgcgcaaggggcc
agcgccgaactggtggcaatggcgaccatcggcgcggccgatgcctttggtctgccggtc
tccacgacgcatgtgctctcatccggcgtggcgggcaccatggcggcgaaccgctctggc
ctgcagatgtccaccctgcgcaatcttgccgtcgcctggatattgacgctgccggtctcg
attttactttctgccctgctctacgggctgttcattcatatctga

DBGET integrated database retrieval system