KEGG   Pantoea stewartii subsp. stewartii: DSJ_11725Help
Entry
DSJ_11725         CDS       T04970                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DSJ_11725
Enzymes [BR:pstw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     DSJ_11725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: ARF49946
UniProt: H3RDW1
Position
2365815..2366507
Genome map
AA seq 230 aa AA seqDB search
MKRADVNRHLQYTRDFFTRQDVPLPSWADYGIRQWRQQQEDITEIVALRLGWDLTSFGGD
DFLQTGLTLFTLRNGSPHGTPWHKPYAEKVMHVREGQVTPMHYHPRKMEDIINRGGGNLI
VELYNREGHDKAATPVTVSLDGIRQTHAAGSQIRLSLGESVTLVAGVWHSFWGENGFGDV
LVGEVSMPNDDDNDNVFLTPLARFNDLDEDEEPQRLLCNDYSRWLTLRSE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgccgacgtgaacagacatttgcaatatacgcgagactttttcacccgtcag
gacgtccctctgccgtcctgggccgattacggtatccggcagtggcgtcagcaacaggag
gacatcactgaaatcgttgccttacgcctgggctgggatctgaccagttttggtggcgac
gattttctgcaaaccggcctgacgttattcacactccgcaacggctcgccgcacggaacg
ccctggcacaaaccttatgcagaaaaagtgatgcacgtgcgtgaagggcaggtaacgccg
atgcattaccatccgcgcaagatggaagacattattaatcgcggcggcggcaacctgatt
gtcgagctgtataaccgtgaaggccatgacaaagccgccacgccggtgacggtttccctg
gacggcatccggcaaacccatgcggcgggttcgcagatcaggctttcccttggtgaaagt
gtcacgctcgtcgcgggcgtctggcacagcttctggggcgaaaacggctttggtgacgtg
ctggtgggggaagtctccatgccaaacgatgatgacaacgacaacgtcttcctgacgccg
ctggcgcgtttcaacgaccttgacgaggatgaggaaccccagaggctgctttgtaacgac
tattcccgctggctcaccttgaggagtgaatga

DBGET integrated database retrieval system