KEGG   Pantoea stewartii subsp. stewartii: DSJ_21230Help
Entry
DSJ_21230         CDS       T04970                                 

Definition
(GenBank) hypothetical protein
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
pstw  Pantoea stewartii subsp. stewartii
Pathway
pstw00520  Amino sugar and nucleotide sugar metabolism
pstw01100  Metabolic pathways
pstw01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pstw_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:pstw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DSJ_21230
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DSJ_21230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pstw01005]
    DSJ_21230
Enzymes [BR:pstw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     DSJ_21230
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     DSJ_21230
Lipopolysaccharide biosynthesis proteins [BR:pstw01005]
 Unusual sugar
  DSJ_21230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Motif
Other DBs
NCBI-ProteinID: ARF51576
UniProt: H3RAD1
Position
complement(4256907..4257827)
Genome map
AA seq 306 aa AA seqDB search
MKAVVFGYHEMACTGLQALLDAGFSISALFTHADPGNATPFYGSVAELARRHAIPVFITE
ELNTAEWQARIASFDADYLFCFSYRQVLSEAILSSVTKGAYNVHAALLPAYRGRAHLNWV
IIKGETRTGVTLHRMIKRPDAGPILAQQAVDILPEDNALALHTRLVATTGKMLPGWLKAL
VAGELTETPQDERAASCWGSRKPEDGEIHWQDSAVNIHNLVRALDFPWPGAFSFTRTQRF
TVWQTRVMNGDNSGRAGEVVSLSPLIIRCGQGQLEILQGQGPDGESVSGRVLASQLGLVV
GQPVNA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtcgtctttggataccatgaaatggcctgtaccggattacaggcgctgctg
gatgccggattcagtatcagtgcgttgtttacccatgccgatcccggcaacgccacacca
ttttatggttccgttgctgagctggcgcgtcgtcacgctattccggtattcatcaccgag
gagttgaataccgccgagtggcaggcccgtatcgccagtttcgacgcggactacctgttc
tgcttctcctaccgtcaggtcctgagcgaggccatcctgtcttcggtaacaaaaggcgcc
tataacgttcatgccgcgctgctgccagcctaccgtggccgcgcccatctcaactgggtc
attatcaagggcgaaacccgtacaggcgttacgctgcaccgcatgattaaacggccagat
gccggtcccatactggcgcagcaggcggtggatattctgccggaagataatgctctggcc
ttgcatacgcgcttagtggcaacgacgggcaagatgttgccgggctggcttaaggcgctg
gtggcgggcgagctgacagaaacaccgcaggatgaacgggccgccagctgctggggcagc
cgcaaacccgaggacggcgagatacattggcaggacagtgccgtcaatatccacaatctg
gttcgggcgctggactttccctggccgggggcgttcagctttacccgcacgcaaaggttt
accgtctggcaaacccgggtgatgaacggcgataacagcgggcgtgcgggtgaggttgta
tcactatcgcccctgatcattcgctgtggacaagggcaactcgaaatcctgcaagggcag
ggcccggacggtgaatctgtttcaggccgggttctggccagtcagcttgggctggtggtg
ggccagcccgtgaatgcctga

DBGET integrated database retrieval system