KEGG   Pedobacter steynii: BFS30_04190Help
Entry
BFS30_04190       CDS       T04469                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psty  Pedobacter steynii
Pathway
psty00480  Glutathione metabolism
psty00590  Arachidonic acid metabolism
psty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BFS30_04190
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BFS30_04190
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BFS30_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AOM76423
UniProt: A0A1D7QCJ5
Position
complement(1061841..1062338)
Genome map
AA seq 165 aa AA seqDB search
MSDNSKSVHQFKVKLINGTEKKLSDFKNKNLLIVNIASACGFAPQLKELQELREELKNED
FEVLAFPSNDFGRQEPLEGEEIHSFCELNYGVQFPVFEKIMVRGEHAHPLFKFLADKKLN
GKLTSTPRWNFHKYLVNKKGEVVDYFFPFTKPLSSKVKKKIQRLG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataactcgaaaagtgtgcaccagtttaaggtaaaattgatcaatggaacagaa
aagaaactttctgactttaaaaacaaaaacttattaattgtaaacatcgcttctgcatgt
ggctttgctcctcagttaaaggagttgcaggagctaagggaagagcttaaaaatgaagat
tttgaagtgcttgcttttccatccaatgatttcggcagacaggagccgctggagggcgaa
gagattcattctttttgcgaattgaattatggcgttcagtttcccgtttttgagaaaatt
atggtcagaggtgagcatgcacacccgctgtttaagtttttggccgataagaagctcaac
ggcaaactgacttccactccaaggtggaacttccataaatacctggtgaataaaaaagga
gaagtagtagattatttcttccctttcaccaaacctttgtcttccaaagtgaagaaaaaa
atacaacgtctgggctag

DBGET integrated database retrieval system