KEGG   Pedobacter steynii: BFS30_05410Help
Entry
BFS30_05410       CDS       T04469                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psty  Pedobacter steynii
Pathway
psty00010  Glycolysis / Gluconeogenesis
psty00053  Ascorbate and aldarate metabolism
psty00071  Fatty acid degradation
psty00280  Valine, leucine and isoleucine degradation
psty00310  Lysine degradation
psty00330  Arginine and proline metabolism
psty00340  Histidine metabolism
psty00380  Tryptophan metabolism
psty00410  beta-Alanine metabolism
psty00561  Glycerolipid metabolism
psty00620  Pyruvate metabolism
psty00625  Chloroalkane and chloroalkene degradation
psty01100  Metabolic pathways
psty01110  Biosynthesis of secondary metabolites
psty01120  Microbial metabolism in diverse environments
psty01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFS30_05410
   00053 Ascorbate and aldarate metabolism
    BFS30_05410
   00620 Pyruvate metabolism
    BFS30_05410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFS30_05410
   00561 Glycerolipid metabolism
    BFS30_05410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFS30_05410
   00310 Lysine degradation
    BFS30_05410
   00330 Arginine and proline metabolism
    BFS30_05410
   00340 Histidine metabolism
    BFS30_05410
   00380 Tryptophan metabolism
    BFS30_05410
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFS30_05410
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BFS30_05410
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BFS30_05410
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BFS30_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Dev_Cell_Death
Motif
Other DBs
NCBI-ProteinID: AOM76644
UniProt: A0A1D7QDF9
Position
complement(1343404..1344804)
Genome map
AA seq 466 aa AA seqDB search
MIQTINSVFKAQQAHKYTLRNTNVTQRINKLSALKASIEKFEKEIYAALKSDLRKSEFES
AITEVIFIYSEIDFAIKNLSSWMEPLSVGKTITGLMAKNRIYYEPKGVCLIIAPWNYPFQ
LMMAPLISAVAAGNCVILKPSELSSETSSIICRVIDDCFTEEEVCCFEGDASLSGILLSL
PFDHIFFTGSTAIGKVVMEAASKNLSSVTLELGGKSPTIIDETADLKQAAAKIAWGKLTN
AGQTCIAPDYILLPVASQEEFIRHYRDAVKRMFFLGNGEIDLSSYAKIINKKHFNRIAGL
IADALDKGAALALGGENDFLNHTIHPTLLTNLPEHAEIMKEEIFGPVLPLITYKSIEEAI
EIVNKMSKPLALYIFSRNKKTIHQVIKNTSSGGACVNDVLIHISNPKLPFGGVNGSGMGS
CHGQFGFKTFSHERAVVFQSSMDMSHIIYPPYEKKGWVLKWLRKLM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacgatcaactccgtttttaaagctcagcaagcgcataaatatacacttaga
aacacgaatgtcacacaacgaattaataaattaagtgcattaaaggccagtatagaaaaa
tttgaaaaagagatctatgcagcattaaagagtgatttgcgtaaaagtgagtttgaatca
gccataacggaggtgatctttatatatagcgaaattgacttcgctataaaaaatctaagc
agttggatggaacccctgtcggtagggaaaacaattacaggcttaatggcaaagaacagg
atttattatgagcctaaaggagtctgtctcattattgcaccctggaattatccctttcag
ctaatgatggctccattgatctcagccgttgctgccggaaattgtgtcattctaaaaccc
tccgaattaagctctgaaaccagttctattatatgccgggttattgacgattgttttacc
gaagaggaggtttgttgctttgaaggggatgcttcactttcaggtattcttttatctctt
ccttttgatcacattttttttaccggaagtaccgctattggtaaggttgtaatggaagcc
gcctcaaaaaatctgagctctgtaaccctggaactgggcggaaaatccccaaccattatt
gatgagaccgccgacctcaaacaggcagcagcaaagattgcctggggaaagctgactaat
gcagggcaaacctgtatcgctcccgactatattctcctacctgttgctagccaggaagaa
tttatcaggcattatagagatgctgtaaagagaatgtttttcctcgggaatggagaaatt
gatctttccagctacgcgaaaatcattaacaaaaaacatttcaacaggattgccggactg
attgcagatgcgctggataaaggtgcggcgttagctctcggaggcgaaaacgacttttta
aaccacacaatacatcctacgttgctgacaaacctccctgaacacgcggaaatcatgaag
gaagaaatatttggtcccgtattacctttaattacttataaatccatagaagaggcgatc
gaaatagtcaacaaaatgagtaagcccttagccctgtatatttttagcagaaataagaaa
accattcatcaggtgatcaaaaacaccagctctggaggagcctgcgtaaacgatgtactc
atccacatcagtaatccgaaacttccttttgggggggtaaacggaagtggaatgggcagt
tgccatggacaattcgggtttaaaactttttcgcacgaaagagctgtcgttttccaatcc
agcatggatatgagtcatatcatctaccccccatacgagaaaaagggttgggtattaaaa
tggcttagaaaactcatgtga

DBGET integrated database retrieval system