KEGG   Pedobacter steynii: BFS30_10380Help
Entry
BFS30_10380       CDS       T04469                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
psty  Pedobacter steynii
Pathway
psty00360  Phenylalanine metabolism
psty00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psty00790  Folate biosynthesis
psty01100  Metabolic pathways
psty01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BFS30_10380
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BFS30_10380
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BFS30_10380
Enzymes [BR:psty01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BFS30_10380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AOM77540
UniProt: A0A1D7QFU6
Position
complement(2509579..2511357)
Genome map
AA seq 592 aa AA seqDB search
MSDFNDFNNPQVAKLPKHLRQFIVEQHYEKYTPIDQAVWRYVMRQNYSYLKHVAYYPYIK
GLQRAGLSIEYIPNLQTMNDNLGKIGWGAVTVDGFIPPAAFMEYQAYRVLVIAADIRQIN
HIEYTPAPDIIHESAGHAPIIADADYNSYLSYFGSIGAKAMFSSKDFELYEAIRNLSILK
ESADASEQEIAKAEKHLQVVAENMGEPSEMALLGRLHWWTVEYGLIGTLEDPKIYGAGLL
SSIGESSSCMKDDVLKKWYTIDAINAQYDITKPQPQLFVTETFQNLIDVLEEFADTMAFR
RGGAESLVKAIECKNPATAVYSSGLQVTGIFTDMGITADDELTFIKTTGPSALAVDHKQL
EGHGKFYHKDGFSSPVGRWNGLALENLSLTELQAQGIATGQTADLTFDSGIHVKGLVKEI
VQHGGKTVLITFEDCTVKEDNGNILFQPEWGIYDMAVGEKIISVFNGAADKDAYEEITHV
SGQQTHKVTYDEKTKKLHAIYSAIRSIRQDKRDYEKCIALFEELKAEHRYDWLAALEILE
IIYHKKLDPEFEKELRVYLELKAANEADYRKLITDGLHVIENPVSQLITEED
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattttaatgactttaacaatccccaggtagcaaagctccctaagcatttaagg
cagtttattgtagagcagcattacgaaaaatatacgccaatcgatcaggctgtttggcgc
tatgtaatgcgtcagaattatagttacctgaaacatgtggcttattatccatatatcaaa
ggactgcaacgtgcaggcctaagtattgaatatatccccaatttgcaaaccatgaacgat
aaccttggcaaaataggctggggtgcggttacggtggatgggtttattcctcctgcagca
ttcatggaataccaggcttaccgggtattggttattgcagcagatattcgtcagatcaac
catattgaatatacacccgctccggatattatccatgagtcggcagggcatgcacccatc
atagcggatgccgactacaacagttacttgagctattttggctctatcggagctaaagcc
atgttctcttccaaagattttgagctttatgaggctatccgcaacctttctatcctgaag
gaatctgcagatgcctcggaacaggaaatcgccaaagcagaaaaacatttgcaggtggtt
gccgagaatatgggcgagccttctgaaatggcgctattgggtcgtctacattggtggaca
gtagaatatggactgataggcacacttgaagaccctaaaatttatggcgcgggtttactt
tcttcgatcggggaaagttccagctgtatgaaagatgacgtgctgaaaaaatggtatacc
atcgatgcaatcaatgcacaatatgacatcaccaagccacagccacaattatttgtgacg
gaaacttttcaaaacctgatagacgttttagaagagtttgctgatactatggcgttcaga
cgtggcggtgctgaaagtctggtcaaagcaattgaatgtaaaaatcctgcaacagcagtt
tacagttctggcttacaggttaccggcatttttacagatatgggcatcactgccgatgac
gagcttacttttataaaaacaaccgggccatctgcactggctgtagaccataaacaactg
gaaggtcatggcaaattctaccataaggacggattctcctcccctgttggcagatggaat
ggtctggcactggaaaatctgagccttactgagctacaggcgcaaggtattgctacaggg
caaaccgcagacctgacttttgacagcgggattcacgtgaaaggactggtaaaagaaatt
gtccagcatggcggtaaaacggtattgatcacatttgaggattgtaccgttaaagaagac
aatggaaatatacttttccaaccggaatggggtatttatgatatggcagtgggagaaaaa
atcatctctgtattcaacggcgcagccgataaagatgcttatgaagaaatcacccatgta
agcggtcagcaaacacataaggtaacttatgatgaaaaaaccaagaaattacatgcgatc
tatagcgctatccgttctataagacaggataaaagagattatgagaaatgtatcgctcta
tttgaagaacttaaagcagaacaccgttacgactggcttgctgctttagaaattctagag
atcatttatcacaagaaactggatcccgaattcgaaaaagagctgcgggtatatctggag
cttaaagcggcaaatgaggcagactaccgtaaattaattacagatggtttacatgtgatt
gaaaaccccgtgagccaattgattactgaagaagattag

DBGET integrated database retrieval system