KEGG   Pedobacter steynii: BFS30_10910Help
Entry
BFS30_10910       CDS       T04469                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
psty  Pedobacter steynii
Brite
KEGG Orthology (KO) [BR:psty00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BFS30_10910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Pox_A9
Motif
Other DBs
NCBI-ProteinID: AOM77631
UniProt: A0A1D7QG45
Position
complement(2632310..2633320)
Genome map
AA seq 336 aa AA seqDB search
MVTTLLVVVIVLAIAFDYINGFHDAANSIATIVSTKVLSPFQAVLWAALFNFAAYFYFTD
HKVANTIAKTVVENFITLEVILAGLLAAITWNLFTWWFGIPSSSSHTLIGGFAGAGMAKA
ATVGAGIMSAINLAPILKVVAFIVLAPVIGMIISVIISIIILHISKNARPSVAEKWFKRL
QLISSAALSFTHGGNDAQKVMGIIYVSMVAANVLKTGDAMPEWIPISCYAAIALGTMSGG
WKIVKTMGSKITKVNAFEGVAAETAGAVTLGITEHFGIPVSTTHTITGSIVGVGLLKRVS
AVRWGVTVSLLWAWVLTIPVSATLAAIVYSVIHLFF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaccttattggttgttgtaattgtcctggcaattgccttcgattatattaat
ggctttcatgatgccgcaaactcaattgcaacaattgtatctacgaaagtattatcccca
ttccaggcagtgttatgggcagcgctcttcaattttgctgcatatttttattttacagac
cataaagtggccaatacgattgctaaaacggttgtggagaacttcattactcttgaagta
atcctcgctggtctgttagcggccatcacatggaacctatttacctggtggtttggcatc
ccttccagttcatcacacacccttattggaggttttgctggtgctggtatggccaaagca
gcaacggttggggccggaataatgtcggctattaaccttgcccctatcctaaaagtggtc
gcctttattgtgctggcccctgtaattggaatgataatttccgtgattatatctattatt
atccttcacatctctaagaatgcaagaccttctgtggcagagaagtggttcaaaaggcta
caattaatctcatctgcagccttaagttttacccatggaggtaatgatgcgcagaaagta
atggggatcatctatgtatccatggtggctgcaaacgtgcttaagacaggcgatgcaatg
ccagaatggattccaatctcttgttacgctgcaattgcattaggaacaatgagtggagga
tggaaaatcgttaaaacaatgggttcaaaaattactaaagtaaatgcctttgaaggtgtt
gcagcagaaacagctggtgcggtgactttaggaattacagaacattttggaataccggtt
tctaccacacacacgattaccggatctattgttggtgtaggcttattgaaaagagtatca
gcagtacgctggggtgtaacagtaagtttattatgggcatgggtattaaccattcctgta
tctgctacccttgccgcaattgtttactcagtgatccatttgttcttttag

DBGET integrated database retrieval system