KEGG   Pedobacter steynii: BFS30_26340Help
Entry
BFS30_26340       CDS       T04469                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
psty  Pedobacter steynii
Pathway
psty00780  Biotin metabolism
psty01100  Metabolic pathways
Module
psty_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:psty00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BFS30_26340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psty01007]
    BFS30_26340
Enzymes [BR:psty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BFS30_26340
Amino acid related enzymes [BR:psty01007]
 Aminotransferase (transaminase)
  Class II
   BFS30_26340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 SHMT SPOR HARE-HTH
Motif
Other DBs
NCBI-ProteinID: AOM80377
UniProt: A0A1D7QP04
Position
6354212..6355345
Genome map
AA seq 377 aa AA seqDB search
MNKTQQFIQDRLNDRKDKGSLRKLSLAHLPVDFCSNDYLGFSRSALLKERIESMLHQVPQ
LSVGSGGSRLLSGNHSFTEQTETLIAAFHQAESGLIFNSGYDANIGLISSLAQRGDTIIS
DELIHASLIDGARLSHASRYTFKHNDLDSLEAKLRLATGNIYVLVESVYSMDGDLAPLIE
INDCCKRHGANLIVDEAHALGIFGAHGKGKVQELSLEKEVFARVVTFGKALGCHGAIVLG
TSALRQYLINFARSFIYTTAAPLHSIICINAAYQLLTETDYTPLITGRIQQYALNMEMAG
ISGKISNSSIQTILYDSNTAAKSAAESLQQKGMDVRAILSPTVPKGTERLRICLHTYNSN
EEIQTLISQLILLRQHE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacccaacagtttatacaagacaggttaaacgacagaaaggataaaggatca
ctaagaaaactatcccttgcccatttgcctgtagacttttgttccaatgattatctgggc
ttctccaggtcagcgcttctcaaagaacgtatagaaagcatgcttcatcaggtaccacag
ctatcggtcggctctggtggttccaggctcctgagcggaaatcattcctttaccgaacag
acagaaacattgatcgcggcatttcaccaggcagaaagcggtttaatctttaactcaggt
tacgatgccaatattggcctcatttccagtctggcacaacgtggagataccatcatctct
gatgaactcattcatgccagcctgatcgacggcgcccggctgagtcatgcgagcagatat
acctttaaacataacgacctggactcgctggaagctaaactcagactggctacaggcaat
atttatgtactcgtagaaagtgtttattccatggacggtgacctggccccattgatagaa
attaatgactgttgtaaaagacatggtgcaaacctgattgtagacgaagcacatgcctta
gggatcttcggagctcatggaaagggaaaggttcaggaactcagtctggaaaaagaggtc
tttgcaagggtggtcaccttcggcaaagctctgggctgtcatggcgccattgttcttggc
acttccgccttacgccaatacctgattaatttcgccagatcttttatttatactacagca
gccccattacatagcatcatctgtattaatgcagcttaccaattacttacagaaacagat
tataccccgctcatcaccggtcggatccagcaatatgccttaaatatggaaatggccgga
atttccggaaagatcagtaacagcagcatacaaacgatactttacgacagcaatactgca
gccaaatctgctgcagaaagtcttcagcagaaaggcatggatgttcgtgccatcttaagc
cctactgttccaaaaggtactgagcggttgagaatttgcctgcacacctataatagcaat
gaagaaattcaaaccctgatcagtcagctgatcttattaagacaacatgaataa

DBGET integrated database retrieval system